8XYJ: Y+LAT1

Structure of y+LAT1 bound with Lys. Determined by electron microscopy at 3.33 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.33 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,582
Mol. weight: 58.11 kDa
Ligands: LYS
Released: 22 Jan 2025

Explore 8XYJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XYJ contains 24 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	40-50	11
α-helix	59-62	4
α-helix	69-97	29
α-helix	114-122	9
α-helix	123-127	5
α-helix	128-144	17
α-helix	145-147	3
α-helix	152-154	3
α-helix	160-175	16
α-helix	177-207	31
α-helix	225-238	14
α-helix	245-247	3
α-helix	255-284	30
α-helix	287-290	4
α-helix	296-304	9
α-helix	306-308	3
α-helix	311-340	30
α-helix	346-349	4
α-helix	359-371	13
α-helix	382-406	25
α-helix	419-437	19
α-helix	440-456	17
α-helix	457-461	5
α-helix	471-483	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Y+L amino acid transporter 1	A	protein	529	Homo sapiens	Q9UM01 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8XYJ_1 Y+L amino acid transporter 1 (chains A)
DYKDDDDKSGPDEVDASGRVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNG
VCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGA
SYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLA
AACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSS
FAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYY
TVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREG
HLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLY
LRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIR
VPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Ligands and cofactors

ID	Name	Formula	Copies
LYS	Lysine	C6 H15 N2 O2	1

Primary citation

Structural basis for the substrate recognition and transport mechanism of the human y + LAT1-4F2hc transporter complex. Dai, L., Zeng, Q., Zhang, T. et al. Sci Adv (2025) 11:eadq0558-eadq0558. DOI 10.1126/sciadv.adq0558 · PubMed

Other PDB entries of the same protein (UniProt Q9UM01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
8XXI 3.04 Å, Structure of y+LAT1 bound with Leu
9I1Z 3.45 Å, Membrane Protein Transporter
9KH5 3.74 Å, Structure of y+LAT1

Browse structure collections

About this viewer

MolViewer shows 8XYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.