9I1Z: Membrane Protein Transporter

Membrane Protein Transporter. Determined by electron microscopy at 3.45 Å resolution. Released 29 Jul 2026.

Method: Electron microscopy
Resolution: 3.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,125
Mol. weight: 124.23 kDa
Ligands: GLN
Released: 29 Jul 2026

Explore 9I1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9I1Z contains 50 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 28 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	37	1	1
α-helix	39-48	10
α-helix	53-56	4
α-helix	61-64	4
α-helix	70-96	27
α-helix	103-107	5
α-helix	115-122	8
α-helix	123-127	5
α-helix	128-143	16
α-helix	152-154	3
α-helix	155-160	6
α-helix	163-175	13
α-helix	179-208	30
α-helix	225-238	14
α-helix	245-251	7
β-strand	252	1	1
α-helix	259-284	26
α-helix	287-292	6
α-helix	296-300	5
α-helix	301-305	5
α-helix	306-308	3
α-helix	311-340	30
α-helix	363-373	11
α-helix	381-383	3
α-helix	386-403	18
α-helix	419-438	20
α-helix	442-451	10
α-helix	454-456	3
α-helix	457-461	5
α-helix	471-482	12

Chain C: 22 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	172-174	3
α-helix	177-198	22
α-helix	202-205	4
α-helix	219-221	3
β-strand	225-227	3	2
α-helix	242-245	4
α-helix	246-248	3
β-strand	261	1	2
β-strand	262	1	3
β-strand	269	1	4
β-strand	272	1	4
α-helix	288-301	14
β-strand	307-308	2	3
α-helix	325-341	17
β-strand	345-347	3	3
α-helix	351-353	3
α-helix	357-371	15
β-strand	376-380	5	3
α-helix	386-394	9
β-strand	400-402	3	3
α-helix	413-426	14
β-strand	433-434	2	5
α-helix	442-444	3
α-helix	448-450	3
α-helix	451-460	10
β-strand	464-465	2	5
β-strand	466-468	3	2
α-helix	471-473	3
α-helix	506-508	3
α-helix	510-513	4
α-helix	520-533	14
α-helix	535-539	5
β-strand	541-544	4	6
β-strand	553-557	5	6
β-strand	563-567	5	6
α-helix	575	1
β-strand	576	1	7
α-helix	577	1
β-strand	593	1	8
β-strand	595-599	5	6
β-strand	611	1	8
β-strand	616	1	7
β-strand	623-627	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Y+L amino acid transporter 1	B	protein	511	Homo sapiens	Q9UM01 (AlphaFold model)
4F2 cell-surface antigen heavy chain	C	protein	630	Homo sapiens	P08195 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9I1Z_1 Y+L amino acid transporter 1 (chains B)
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPK
GVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRL
WTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWG
TLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYS
GWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTF
ADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVP
SLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSAT
RYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Sequence of entity 2 (C), FASTA

>9I1Z_2 4F2 cell-surface antigen heavy chain (chains C)
MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPS
ASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEP
EKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVR
TRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGN
LAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKK
SIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFL
AEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT
QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALP
GQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD
FHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQ
PGREEGSPLELERLKLEPHEGLLLRFPYAA

Ligands and cofactors

ID	Name	Formula	Copies
GLN	Glutamine	C5 H10 N2 O3	1

Primary citation

Membrane Protein Transporter. Aparicio, D., Palacin, M., Llorca, O. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UM01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
8XXI 3.04 Å, Structure of y+LAT1 bound with Leu
8XYJ 3.33 Å, Structure of y+LAT1 bound with Lys
9KH5 3.74 Å, Structure of y+LAT1

Browse structure collections

About this viewer

MolViewer shows 9I1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.