8Y59: TRIM21 PRYSPRY

Crystal structure of TRIM21 PRYSPRY (D355A) in complex with (S)-hydroxyl-acepromazine. Determined by X-ray diffraction at 1.89 Å resolution. Released 9 Oct 2024.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,593
Mol. weight: 21.93 kDa
Ligands: A1D5Y
Released: 9 Oct 2024

Explore 8Y59 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Y59 contains 4 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	8	1	2
α-helix	10-12	3
β-strand	17-19	3	1
β-strand	25-28	4	1
β-strand	48-49	2	3
β-strand	50	1	2
β-strand	54	1	3
β-strand	58-64	7	1
β-strand	71-77	7	3
α-helix	90-92	3
β-strand	94-100	7	3
β-strand	104-107	4	3
β-strand	113-115	3	3
β-strand	123-129	7	1
β-strand	134-139	6	1
β-strand	145-150	6	1
β-strand	159-164	6	3
α-helix	175-176	2
β-strand	177-179	3	1
α-helix	180-181	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase TRIM21	A	protein	192	Homo sapiens	P19474 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8Y59_1 E3 ubiquitin-protein ligase TRIM21 (chains A)
GPMVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHY
WEVDVTGKEAWALGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVP
PCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLC
PLNIGSQGSTDY

Ligands and cofactors

ID	Name	Formula	Copies
A1D5Y	(1~{S})-1-[10-[3-(dimethylamino)propyl]phenothiazin-2-yl]ethanol	C19 H24 N2 O S	1

Primary citation

Selective degradation of multimeric proteins by TRIM21-based molecular glue and PROTAC degraders. Lu, P., Cheng, Y., Xue, L. et al. Cell (2024) 187:7126-7142.e20. DOI 10.1016/j.cell.2024.10.015 · PubMed

Other PDB entries of the same protein (UniProt P19474 (AlphaFold model), which also has an AlphaFold model), best resolution first:

32QO 1.3 Å, Human TRIM21 PRYSPRY domain in complex with compound 28 (Z38)
9PLM 1.32 Å, TRIM21-NUP98 Molecular Glue Complex (MAN-021)
32QL 1.4 Å, Human TRIM21 PRYSPRY domain in complex with HGC652
9QBA 1.45 Å, Human TRIM21 PRYSPRY domain in complex with AL236
9II5 1.49 Å, Crystal structure of human TRIM21 PRYSPRY in complex with compound 1
32QM 1.5 Å, Human TRIM21 PRYSPRY domain in complex with compound 5 (Z31)
8Y58 1.6 Å, Crystal structure of TRIM21 PRYSPRY (D355A) in complex with acepromazine.
9PLL 1.6 Å, TRIM21-NUP98 Molecular Glue Complex (MAN-056)
8Y5B 1.74 Å, Crystal structure of TRIM21 PRYSPRY (D355A) in complex with (R)-hydroxyl-acepromazine.
32QN 1.8 Å, Human TRIM21 PRYSPRY domain in complex with compound 29 (Z37)
5OLM 1.95 Å, TRIM21
9M3N 2.08 Å, Crystal structure of human TRIM21 PRYSPRY in complex with T-02

Browse structure collections

About this viewer

MolViewer shows 8Y59 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.