8YAP: Human PALB2 coiled-coil domain

Structure of human PALB2 coiled-coil domain. Determined by solution NMR. Released 12 Feb 2025.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 594
Mol. weight: 8.89 kDa
Released: 12 Feb 2025

Explore 8YAP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YAP contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-40	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partner and localizer of BRCA2	A, B	protein	37	Homo sapiens	Q86YC2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8YAP_1 Partner and localizer of BRCA2 (chains A, B)
GKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAW

Primary citation

Structural analysis of genetic variants of the human tumor suppressor PALB2 coiled-coil domain. Reddy, P.P., Phale, A., Das, R. Biosci Rep (2025) 45. DOI 10.1042/BSR20241173 · PubMed

Other PDB entries of the same protein (UniProt Q86YC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W18 1.9 Å, Crystal structure of the C-terminal WD40 domain of human PALB2
3EU7 2.2 Å, Crystal Structure of a PALB2 / BRCA2 complex
7S4A 2.69 Å, MRG15 complex with PALB2 peptide

Browse structure collections

About this viewer

MolViewer shows 8YAP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.