8YLP: Overall structure of the y+LAT1-4F2hc

Overall structure of the y+LAT1-4F2hc bound with Arg. Determined by electron microscopy at 2.9 Å resolution. Released 12 Mar 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,397
Mol. weight: 129.67 kDa
Ligands: ARG
Released: 12 Mar 2025

Explore 8YLP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YLP contains 46 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	167-173	7
α-helix	180-205	26
α-helix	212-214	3
α-helix	219-221	3
β-strand	225-228	4	1
α-helix	232-235	4
α-helix	244-248	5
α-helix	249-255	7
β-strand	259-262	4	1
β-strand	266-267	2	2
β-strand	277-281	5	2
α-helix	288-300	13
β-strand	304-308	5	1
α-helix	325-341	17
β-strand	345-348	4	1
α-helix	351-353	3
α-helix	357-371	15
β-strand	376-380	5	1
α-helix	386-391	6
β-strand	400-402	3	1
α-helix	413-427	15
β-strand	432-434	3	3
α-helix	442-444	3
α-helix	448-450	3
α-helix	451-459	9
β-strand	463-465	3	3
β-strand	466-468	3	1
α-helix	488-490	3
α-helix	510-513	4
α-helix	520-531	12
α-helix	535-538	4
β-strand	541-545	5	4
β-strand	551-557	7	4
β-strand	563-569	7	4
β-strand	575-576	2	5
α-helix	586-588	3
β-strand	593-594	2	6
β-strand	599	1	4
β-strand	610-611	2	6
β-strand	616-617	2	5
β-strand	622-627	6	4

Chain B: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	39-50	12
α-helix	54-57	4
α-helix	61-66	6
α-helix	69-97	29
α-helix	104-111	8
α-helix	114-122	9
α-helix	123-127	5
α-helix	128-143	16
α-helix	155-175	21
α-helix	177-208	32
α-helix	225-238	14
α-helix	245-251	7
α-helix	255-284	30
α-helix	287-290	4
α-helix	296-304	9
α-helix	311-340	30
α-helix	346-349	4
β-strand	351-352	2	7
α-helix	359-372	14
α-helix	379-383	5
α-helix	386-406	21
α-helix	419-437	19
α-helix	440-451	12
α-helix	454-456	3
α-helix	457-461	5
α-helix	470-487	18
β-strand	489-490	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amino acid transporter heavy chain SLC3A2	A	protein	645	Homo sapiens	P08195 (AlphaFold model)
Y+L amino acid transporter 1	B	protein	529	Homo sapiens	Q9UM01 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8YLP_1 Amino acid transporter heavy chain SLC3A2 (chains A)
HHHHHHHHHHSGRELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTG
LELLASGDPLPSASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEV
DMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEE
LLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIG
DLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKE
DFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVR
DIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDS
GSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSY
GDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSD
QRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASAS
LPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAATGA

Sequence of entity 2 (B), FASTA

>8YLP_2 Y+L amino acid transporter 1 (chains B)
DYKDDDDKSGPDEVDASGRVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNG
VCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGA
SYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLA
AACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSS
FAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYY
TVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREG
HLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLY
LRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIR
VPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Ligands and cofactors

ID	Name	Formula	Copies
ARG	Arginine	C6 H15 N4 O2	1

Primary citation

Structural basis for the substrate recognition and transport mechanism of the human y + LAT1-4F2hc transporter complex. Dai, L., Zeng, Q., Zhang, T. et al. Sci Adv (2025) 11:eadq0558-eadq0558. DOI 10.1126/sciadv.adq0558 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu
8A6L 3.18 Å, Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs

Browse structure collections

About this viewer

MolViewer shows 8YLP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.