8YQN: Torpedo acetylcholine receptor
Torpedo acetylcholine receptor in complex with Erabutoxin A. Determined by electron microscopy at 2.27 Å resolution. Released 28 May 2025.
- Method
- Electron microscopy
- Resolution
- 2.27 Å
- Organisms
- Tetronarce californica, Laticauda semifasciata
- Chains
- 7
- Atoms
- 18,056
- Mol. weight
- 291.06 kDa
- Ligands
- POV, PLM, OCT, NAG
- Released
- 28 May 2025
Explore 8YQN in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8YQN contains 81 α-helices and 97 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 14 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-11 | 9 | |
| β-strand | 29-44 | 16 | 1 |
| β-strand | 49-61 | 13 | 1 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 95 | 1 | 1 |
| β-strand | 108-111 | 4 | 1 |
| β-strand | 115-118 | 4 | 1 |
| β-strand | 121-127 | 7 | 1 |
| β-strand | 139-148 | 10 | 2 |
| β-strand | 156-160 | 5 | 1 |
| β-strand | 166 | 1 | 1 |
| α-helix | 170-172 | 3 | |
| β-strand | 176-188 | 13 | 2 |
| β-strand | 198-209 | 12 | 2 |
| α-helix | 213-214 | 2 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-231 | 12 | |
| α-helix | 232-234 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 307-309 | 3 | |
| α-helix | 310-318 | 9 | |
| α-helix | 320-323 | 4 | |
| β-strand | 329 | 1 | 3 |
| α-helix | 375-433 | 59 | |
Chain B: 16 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-9 | 6 | |
| α-helix | 10-14 | 5 | |
| β-strand | 31-46 | 16 | 4 |
| β-strand | 51-63 | 13 | 4 |
| α-helix | 71-73 | 3 | |
| β-strand | 80-82 | 3 | 4 |
| β-strand | 93-94 | 2 | 5 |
| β-strand | 97 | 1 | 4 |
| α-helix | 108-109 | 2 | |
| β-strand | 110-112 | 3 | 4 |
| β-strand | 117-120 | 4 | 4 |
| β-strand | 123-129 | 7 | 4 |
| β-strand | 141-149 | 9 | 5 |
| β-strand | 158-162 | 5 | 4 |
| β-strand | 164-166 | 3 | 6 |
| β-strand | 171-173 | 3 | 6 |
| β-strand | 176 | 1 | 7 |
| β-strand | 178 | 1 | 4 |
| α-helix | 184-187 | 4 | |
| β-strand | 190-194 | 5 | 5 |
| β-strand | 196 | 1 | 7 |
| β-strand | 197-201 | 5 | 5 |
| β-strand | 213-223 | 11 | 5 |
| α-helix | 227-228 | 2 | |
| α-helix | 229-233 | 5 | |
| α-helix | 234-240 | 7 | |
| α-helix | 242-245 | 4 | |
| α-helix | 251-253 | 3 | |
| α-helix | 256-274 | 19 | |
| α-helix | 287-313 | 27 | |
| α-helix | 324-328 | 5 | |
| α-helix | 329-333 | 5 | |
| α-helix | 334-337 | 4 | |
| α-helix | 417-477 | 61 | |
Chain C: 19 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-42 | 14 | 8 |
| β-strand | 49-61 | 13 | 8 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 8 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 9 |
| β-strand | 95 | 1 | 8 |
| β-strand | 104 | 1 | 8 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-111 | 4 | 8 |
| β-strand | 115-118 | 4 | 8 |
| β-strand | 121-127 | 7 | 8 |
| β-strand | 139-148 | 10 | 9 |
| β-strand | 156-160 | 5 | 8 |
| α-helix | 161 | 1 | |
| β-strand | 162 | 1 | 10 |
| α-helix | 163 | 1 | |
| β-strand | 169 | 1 | 10 |
| β-strand | 172 | 1 | 11 |
| β-strand | 174 | 1 | 8 |
| α-helix | 177-179 | 3 | |
| β-strand | 181 | 1 | 8 |
| β-strand | 186-190 | 5 | 9 |
| β-strand | 192 | 1 | 11 |
| β-strand | 193-198 | 6 | 9 |
| β-strand | 201-215 | 15 | 9 |
| α-helix | 218-220 | 3 | |
| α-helix | 221-225 | 5 | |
| α-helix | 226-237 | 12 | |
| α-helix | 238-240 | 3 | |
| α-helix | 243-245 | 3 | |
| α-helix | 248-266 | 19 | |
| α-helix | 279-305 | 27 | |
| β-strand | 312 | 1 | 12 |
| α-helix | 316-320 | 5 | |
| α-helix | 321-325 | 5 | |
| α-helix | 326-330 | 5 | |
| α-helix | 333-335 | 3 | |
| α-helix | 399-459 | 61 | |
Chain D: 14 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 13 |
| β-strand | 49-61 | 13 | 13 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 13 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 14 |
| β-strand | 95 | 1 | 13 |
| β-strand | 108-111 | 4 | 13 |
| β-strand | 115-118 | 4 | 13 |
| β-strand | 121-127 | 7 | 13 |
| β-strand | 139-148 | 10 | 14 |
| β-strand | 156-160 | 5 | 13 |
| β-strand | 166 | 1 | 13 |
| α-helix | 170-172 | 3 | |
| β-strand | 176-188 | 13 | 14 |
| β-strand | 198-209 | 12 | 14 |
| α-helix | 213-214 | 2 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-231 | 12 | |
| α-helix | 232-234 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-314 | 5 | |
| α-helix | 315-319 | 5 | |
| α-helix | 320-323 | 4 | |
| β-strand | 329 | 1 | 12 |
| α-helix | 370-432 | 63 | |
Chain E: 14 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-12 | 9 | |
| β-strand | 29-44 | 16 | 15 |
| β-strand | 49-66 | 18 | 15 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 15 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 16 |
| β-strand | 95 | 1 | 15 |
| β-strand | 107-111 | 5 | 15 |
| β-strand | 113-118 | 6 | 15 |
| β-strand | 121-127 | 7 | 15 |
| α-helix | 129-131 | 3 | |
| β-strand | 139-148 | 10 | 16 |
| β-strand | 156-160 | 5 | 15 |
| β-strand | 162-163 | 2 | 17 |
| β-strand | 166-167 | 2 | 17 |
| β-strand | 170 | 1 | 18 |
| β-strand | 172 | 1 | 15 |
| α-helix | 178-180 | 3 | |
| β-strand | 184-188 | 5 | 16 |
| β-strand | 190 | 1 | 18 |
| β-strand | 191-195 | 5 | 16 |
| β-strand | 207-217 | 11 | 16 |
| α-helix | 221-222 | 2 | |
| α-helix | 223-227 | 5 | |
| α-helix | 228-234 | 7 | |
| α-helix | 235-242 | 8 | |
| α-helix | 251-270 | 20 | |
| α-helix | 282-308 | 27 | |
| β-strand | 315 | 1 | 3 |
| α-helix | 319-325 | 7 | |
| α-helix | 329-332 | 4 | |
| α-helix | 416-472 | 57 | |
Chain F: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 19 |
| α-helix | 11-12 | 2 | |
| β-strand | 14-16 | 3 | 19 |
| α-helix | 17-18 | 2 | |
| β-strand | 24-30 | 7 | 20 |
| β-strand | 35-41 | 7 | 20 |
| β-strand | 51-54 | 4 | 20 |
Chain G: 2 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-4 | 3 | 21 |
| β-strand | 7 | 1 | 22 |
| α-helix | 11-12 | 2 | |
| β-strand | 14-16 | 3 | 21 |
| α-helix | 17-18 | 2 | |
| β-strand | 25-30 | 6 | 22 |
| β-strand | 35-40 | 6 | 22 |
| β-strand | 51-54 | 4 | 22 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine receptor subunit alpha | A, D | protein | 437 | Tetronarce californica | P02710 (AlphaFold model) |
| Acetylcholine receptor subunit delta | B | protein | 501 | Tetronarce californica | P02718 (AlphaFold model) |
| Acetylcholine receptor subunit beta | C | protein | 469 | Tetronarce californica | P02712 (AlphaFold model) |
| Acetylcholine receptor subunit gamma | E | protein | 489 | Tetronarce californica | P02714 (AlphaFold model) |
| Erabutoxin a | F, G | protein | 62 | Laticauda semifasciata | P60775 |
Sequence of entity 1 (A, D), FASTA
>8YQN_1 Acetylcholine receptor subunit alpha (chains A, D)
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQW
IDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTP
PAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKD
YRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHH
RSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEV
IFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICII
GTVSVFAGRLIELSQEG
Sequence of entity 2 (B), FASTA
>8YQN_2 Acetylcholine receptor subunit delta (chains B)
VNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDH
AWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTW
LPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIID
PEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLIS
FLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVT
GVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRS
SSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIK
SGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNH
PPAKPFEGDPFDYSSDHPRCA
Sequence of entity 3 (C), FASTA
>8YQN_3 Acetylcholine receptor subunit beta (chains C)
SVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAW
TDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQP
SAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAF
TENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFY
LPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVV
VLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKP
AGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASE
FDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA
Sequence of entity 4 (E), FASTA
>8YQN_4 Acetylcholine receptor subunit gamma (chains E)
ENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQW
NDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLP
PAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTE
NGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLV
YFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMN
CVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIK
AEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEAC
NFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPF
PGDPRKYVP
Sequence of entity 5 (F, G), FASTA
>8YQN_5 Erabutoxin a (chains F, G)
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVC
NN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| POV | (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl… | C42 H82 N O8 P | 4 |
| PLM | Palmitic acid | C16 H32 O2 | 1 |
| OCT | N-octane | C8 H18 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Primary citation
Structure of Erabutoxin bound to Torpedo acetylcholine receptor gives insight to intramolecular selectivity. Chan, C.Y.L., Li, H.H., Hibbs, R.E. et al. To be published.
Other PDB entries of the same protein (UniProt P02710 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7QL5 2.5 Å, Torpedo muscle-type nicotinic acetylcholine receptor - nicotine-bound conformation
- 7SMM 2.5 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form
- 7SMT 2.56 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with d-tubocurarine and…
- 6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
- 8F6Z 2.7 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
- 7SMQ 2.74 Å, Cryo-EM structure of Torpedo acetylcholine receptor in apo form with added cholesterol
- 7SMR 2.77 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with carbachol,…
- 8F6Y 2.79 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with etomidate,…
- 9E3E 2.8 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Diliganded State
- 7QKO 2.9 Å, Torpedo muscle-type nicotinic acetylcholine receptor - Resting conformation
- 8ESK 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
- 8F2S 2.9 Å, Cryo-EM structure of Torpedo nicotinic acetylcholine receptor in complex with…
Browse structure collections
About this viewer
MolViewer shows 8YQN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.