8YU7: CXCR4 tetramer

Cryo-EM structure of CXCR4 tetramer. Determined by electron microscopy at 3.01 Å resolution. Released 5 Mar 2025.

Method: Electron microscopy
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,616
Mol. weight: 166.36 kDa
Ligands: CLR
Released: 5 Mar 2025

Explore 8YU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YU7 contains 56 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	37-60	24
α-helix	61-65	5
α-helix	73-99	27
α-helix	107-139	33
α-helix	146-150	5
α-helix	151-155	5
α-helix	156-174	19
β-strand	177-178	2	1
β-strand	185-186	2	1
α-helix	193-204	12
α-helix	205-209	5
α-helix	210-225	16
α-helix	233-236	4
α-helix	239-250	12
α-helix	253-266	14
α-helix	275-304	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C chemokine receptor type 4	A, B, C, D	protein	351	Homo sapiens	P61073 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8YU7_1 C-X-C chemokine receptor type 4 (chains A, B, C, D)
EGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVIL
VMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLY
SSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEAD
DRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTT
VILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPIL
YAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	20

Primary citation

Structural basis of CXCR4 assembly and regulation. Liu, A., Liu, Y., Ye, R.D. Cell Rep (2025) 44:115255-115255. DOI 10.1016/j.celrep.2025.115255 · PubMed

Other PDB entries of the same protein (UniProt P61073 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ODU 2.5 Å, The 2.5 A structure of the CXCR4 chemokine receptor in complex with small molecule…
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
8U4N 2.72 Å, Structure of Apo CXCR4/Gi complex
9UPU 2.8 Å, Cryo-EM strucutre of CXCR4 complexed with agonist SDV1a
8K3Z 2.81 Å, Cryo-EM structure of CXCR4 in complex with CXCL12
3OE0 2.9 Å, Crystal structure of the CXCR4 chemokine receptor in complex with a cyclic peptide…
9MDU 2.9 Å, Human CXCR4 tetramer
8ZPL 3.01 Å, Cryo-EM strucutre of CXCR4 complexed with antagonist HF51116
3OE8 3.1 Å, Crystal structure of the CXCR4 chemokine receptor in complex with a small molecule…
3OE9 3.1 Å, Crystal structure of the chemokine CXCR4 receptor in complex with a small molecule…
4RWS 3.1 Å, Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community…
8U4R 3.1 Å, Structure of REGN7663-Fab bound CXCR4

Browse structure collections

About this viewer

MolViewer shows 8YU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.