Crystal structure of the chemokine CXCR4 receptor in complex with a small molecule antagonist IT1t in P1 spacegroup. Determined by X-ray diffraction at 3.1 Å resolution. Released 27 Oct 2010.
Explore 3OE9 in 3D Show helices and sheets RCSB PDB PDBe
3OE9 contains 51 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 41-64 | 24 | |
| α-helix | 72-88 | 17 | |
| α-helix | 91-99 | 9 | |
| α-helix | 106-138 | 33 | |
| α-helix | 148-150 | 3 | |
| α-helix | 151-155 | 5 | |
| α-helix | 156 | 1 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-166 | 5 | |
| α-helix | 170-173 | 4 | |
| β-strand | 175-178 | 4 | 1 |
| β-strand | 185-188 | 4 | 1 |
| α-helix | 194-197 | 4 | |
| α-helix | 199-204 | 6 | |
| α-helix | 205-209 | 5 | |
| α-helix | 210-226 | 17 | |
| α-helix | 1002-1010 | 9 | |
| β-strand | 1013-1015 | 3 | 2 |
| β-strand | 1016 | 1 | 3 |
| β-strand | 1017-1018 | 2 | 2 |
| β-strand | 1025-1029 | 5 | 2 |
| β-strand | 1031-1034 | 4 | 2 |
| α-helix | 1039-1050 | 12 | |
| β-strand | 1057 | 1 | 3 |
| α-helix | 1060-1078 | 19 | |
| α-helix | 1084-1090 | 7 | |
| α-helix | 1093-1103 | 11 | |
| α-helix | 1108-1112 | 5 | |
| α-helix | 1115-1122 | 8 | |
| α-helix | 1126-1134 | 9 | |
| α-helix | 1143-1155 | 13 | |
| α-helix | 239-266 | 28 | |
| α-helix | 275-291 | 17 | |
| α-helix | 292-297 | 6 | |
| α-helix | 299-301 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-62 | 26 | |
| α-helix | 75-99 | 25 | |
| α-helix | 105-138 | 34 | |
| α-helix | 148-150 | 3 | |
| α-helix | 151-155 | 5 | |
| α-helix | 156 | 1 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-165 | 4 | |
| α-helix | 169-174 | 6 | |
| β-strand | 175-178 | 4 | 4 |
| β-strand | 185-188 | 4 | 4 |
| α-helix | 193-204 | 12 | |
| α-helix | 205-209 | 5 | |
| α-helix | 210-1010 | 28 | |
| β-strand | 1013-1014 | 2 | 5 |
| β-strand | 1025-1027 | 3 | 6 |
| β-strand | 1028-1029 | 2 | 5 |
| β-strand | 1031-1034 | 4 | 6 |
| α-helix | 1039-1049 | 11 | |
| α-helix | 1060-1078 | 19 | |
| α-helix | 1085-1090 | 6 | |
| α-helix | 1093-1105 | 13 | |
| α-helix | 1108-1111 | 4 | |
| α-helix | 1115-1121 | 7 | |
| α-helix | 1126-1133 | 8 | |
| α-helix | 1137-1141 | 5 | |
| α-helix | 1143-1155 | 13 | |
| α-helix | 239-266 | 28 | |
| α-helix | 274-290 | 17 | |
| α-helix | 293-295 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-X-C chemokine receptor type 4, Lysozyme Chimera | A, B | protein | 499 | Homo Sapiens, Enterobacteria phage T4 | P00720, P61073 (AlphaFold model) |
>3OE9_1 C-X-C chemokine receptor type 4, Lysozyme Chimera (chains A, B) DYKDDDDAGAPEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL TGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCK AVHVIYTVNLYSSVWILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIP DFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHNI FEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQ KRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYSGSGHQKRKALKPTVILILAFF ACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKF KTSAQHALTSGRPLEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ITD | (6,6-dimethyl-5,6-dihydroimidazo[2,1-b][1,3]thiazol-3-yl)methyl… | C21 H34 N4 S2 | 2 |
Structures of the CXCR4 chemokine GPCR with small-molecule and cyclic peptide antagonists. Wu, B., Chien, E.Y., Mol, C.D. et al. Science (2010) 330:1066-1071. DOI 10.1126/science.1194396 · PubMed
Other PDB entries of the same protein (UniProt P00720), best resolution first:
MolViewer shows 3OE9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.