8YUE: Protein claret segregational

Name: PDB 8YUE: Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
Published: 2025-04-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: motor protein

Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster. Determined by X-ray diffraction at 3.15 Å resolution. Released 9 Apr 2025.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 5,793
Mol. weight: 90.15 kDa
Ligands: PO4, ADP
Released: 9 Apr 2025

Explore 8YUE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YUE contains 26 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	293-346	54
β-strand	349-355	7	1
α-helix	356-359	4
α-helix	360-362	3
β-strand	367	1	2
β-strand	369-371	3	3
β-strand	377-381	5	3
β-strand	395-397	3	3
β-strand	400-402	3	1
α-helix	408-423	16
β-strand	428-431	4	1
α-helix	440-444	5
β-strand	446	1	4
β-strand	451	1	4
α-helix	453-468	16
β-strand	473-474	2	1
β-strand	477-479	3	1
β-strand	482-485	4	1
β-strand	488-491	4	1
β-strand	502-505	4	5
β-strand	508-514	7	5
β-strand	520-521	2	1
α-helix	522	1
α-helix	525-536	12
α-helix	550-552	3
β-strand	554-565	12	1
β-strand	570-580	11	1
α-helix	600-615	16
α-helix	622-624	3
α-helix	626-631	6
α-helix	632-634	3
β-strand	640-647	8	1
β-strand	650	1	2
α-helix	654-669	16

Chain B: 12 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	292-346	55
β-strand	349-355	7	6
α-helix	356-358	3
β-strand	369-372	4	7
β-strand	377-381	5	7
β-strand	395-397	3	7
β-strand	400-402	3	6
α-helix	408-423	16
β-strand	428-433	6	6
α-helix	440-443	4
α-helix	453-471	19
β-strand	473	1	8
β-strand	476-477	2	9
β-strand	478-479	2	10
β-strand	481-484	4	6
β-strand	491	1	6
β-strand	502-504	3	11
β-strand	512-514	3	11
β-strand	520-521	2	10
α-helix	525-539	15
β-strand	554-557	4	6
β-strand	559-562	4	9
β-strand	565	1	8
β-strand	574-576	3	9
β-strand	577-580	4	6
α-helix	603-614	12
α-helix	626-630	5
α-helix	632-636	5
β-strand	640-647	8	6
α-helix	651-653	3
α-helix	654-668	15
α-helix	670-672	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein claret segregational	A, B	protein	390	Drosophila melanogaster	P20480 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8YUE_1 Protein claret segregational (chains A, B)
SMHAALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIR
VFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSD
IFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRN
LGWEYEIKATFLEIKNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRH
LMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTS
TRMTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPF
QDCFQESVKSLRFAASVNSCKMTKAKRNRY

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Structural analysis of a motor with increased mechanical output reveals new transitions in kinesin microtubule motility. Shibata, S., Wang, M.Y., Imasaki, T. et al. Sci Rep (2026) 16:487-487. DOI 10.1038/s41598-025-28573-7 · PubMed

Other PDB entries of the same protein (UniProt P20480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U06 2.35 Å, Crystal structure of the kinesin-14 NcdG347D
1N6M 2.5 Å, Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor…
2NCD 2.5 Å, Ncd (non-claret disjunctional) dimer from D. Melanogaster
3L1C 2.75 Å, Kinesin-14 Protein Ncd, T436S Mutant
5W3D 2.79 Å, The structure of kinesin-14 wild-type Ncd-ADP dimer
1CZ7 2.9 Å, The crystal structure of a minus-end directed microtubule motor protein ncd reveals…
5HLE 2.9 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP…
8YY3 3.24 Å, Kinesin-14 in nucleotide-free state bound to 14 PF Microtubule
8YY2 3.6 Å, Kinesin-14 in nucleotide-free state bound to 13 PF Microtubule
8YY5 3.99 Å, Kinesin-14 with AlF3 bound to 14 PF Microtubule
8YY4 4.02 Å, Kinesin-14 with AlF3 bound to 13 PF Microtubule
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…

Browse structure collections

About this viewer

MolViewer shows 8YUE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.