5HLE: PDB entry 5HLE

Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP state. Determined by X-ray diffraction at 2.9 Å resolution. Released 25 Jan 2017.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Drosophila melanogaster, Rattus norvegicus
Chains: 1
Atoms: 2,400
Mol. weight: 42.07 kDa
Ligands: ADP, MG
Released: 25 Jan 2017

Explore 5HLE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HLE contains 14 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	1
α-helix	32-34	3
α-helix	36-40	5
β-strand	45	1	2
β-strand	48	1	3
β-strand	54-55	2	4
β-strand	56	1	3
β-strand	62-63	2	4
β-strand	66-68	3	1
α-helix	74-81	8
α-helix	83-89	7
β-strand	95-100	6	1
α-helix	107-111	5
β-strand	113	1	5
β-strand	121	1	5
α-helix	123-134	12
α-helix	135-137	3
β-strand	142-154	13	1
β-strand	157-160	4	1
β-strand	171-173	3	6
β-strand	179-181	3	6
β-strand	187-189	3	1
α-helix	192-205	14
α-helix	217-219	3
β-strand	221-232	12	1
β-strand	238-247	10	1
α-helix	273-284	12
α-helix	293-295	3
α-helix	297-301	5
α-helix	302-305	4
β-strand	311-318	8	1
β-strand	321	1	2
α-helix	325-333	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein claret segregational,Minus-end kinesin-1/kinesin-14,Protein claret segregational	A	protein	371	Drosophila melanogaster, Rattus norvegicus	P20480 (AlphaFold model), P56536 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5HLE_1 Protein claret segregational,Minus-end kinesin-1/kinesin-14,Protein claret segregational (chains A)
KEQLFQSNMERKELHNTVMDLRGNIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIQGK
PYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQL
MGIIPRIAHDIFDHIYSMDENLEFAIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPY
VKGCTERFVSSPEEVMDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLS
GKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTTHVPYRDSKMTR
ILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFAASVNSCKMTKAKRNRYLNNSVANSS
TQSNNSGSFDK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Primary citation

Backwards motion in kinesin-14 requires neck-mimic to control a neck-helix swing. Yamagishi, M., Shigematsu, H., Yokoyama, T. et al. To be published.

Other PDB entries of the same protein (UniProt P20480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U06 2.35 Å, Crystal structure of the kinesin-14 NcdG347D
1N6M 2.5 Å, Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor…
2NCD 2.5 Å, Ncd (non-claret disjunctional) dimer from D. Melanogaster
3L1C 2.75 Å, Kinesin-14 Protein Ncd, T436S Mutant
5W3D 2.79 Å, The structure of kinesin-14 wild-type Ncd-ADP dimer
1CZ7 2.9 Å, The crystal structure of a minus-end directed microtubule motor protein ncd reveals…
8YUE 3.15 Å, Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
8YY3 3.24 Å, Kinesin-14 in nucleotide-free state bound to 14 PF Microtubule
8YY2 3.6 Å, Kinesin-14 in nucleotide-free state bound to 13 PF Microtubule
8YY5 3.99 Å, Kinesin-14 with AlF3 bound to 14 PF Microtubule
8YY4 4.02 Å, Kinesin-14 with AlF3 bound to 13 PF Microtubule
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…

Browse structure collections

About this viewer

MolViewer shows 5HLE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.