8Z50: ASF1-H3T-H4 complex

Crystal structure of the ASF1-H3T-H4 complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 3 Jul 2024.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,452
Mol. weight: 47.55 kDa
Released: 3 Jul 2024

Explore 8Z50 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Z50 contains 13 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	1
β-strand	16-17	2	2
α-helix	21	1
β-strand	22-30	9	1
β-strand	34	1	3
β-strand	38-45	8	2
α-helix	51-53	3
β-strand	54-62	9	2
β-strand	65	1	3
β-strand	68-76	9	1
α-helix	77-79	3
α-helix	81-83	3
α-helix	86-89	4
β-strand	91-101	11	2
β-strand	104-117	14	2
α-helix	120-124	5
α-helix	132-134	3
β-strand	135-139	5	2
β-strand	145-148	4	2

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	64-78	15
β-strand	83	1	4
α-helix	86-113	28
β-strand	118-119	2	5
α-helix	121-131	11

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	45-46	2	5
α-helix	48-74	27
β-strand	80	1	4
α-helix	83-93	11
β-strand	95-97	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone chaperone ASF1A	A	protein	180	Homo sapiens	Q9Y294 (AlphaFold model)
Histone H3.1t	B	protein	136	Homo sapiens	Q16695 (AlphaFold model)
Histone H4	C	protein	103	Homo sapiens	P62805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8Z50_1 Histone chaperone ASF1A (chains A)
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSV
LVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTET
ELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLEHHHHHH

Sequence of entity 2 (B), FASTA

>8Z50_2 Histone H3.1t (chains B)
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTI
MPKDIQLARRIRGERA

Sequence of entity 3 (C), FASTA

>8Z50_3 Histone H4 (chains C)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Primary citation

Structural insights into instability of the nucleosome driven by histone variant H3T. Hu, S., Liu, Y., Yang, Y. et al. Biochem Biophys Res Commun (2024) 727:150307-150307. DOI 10.1016/j.bbrc.2024.150307 · PubMed

Other PDB entries of the same protein (UniProt Q9Y294 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SVO 1.6 Å, Crystal structure hASF1A 156-cr5
9TRB 1.65 Å, Crystal structure hASF1A 156-cr13
9SQK 1.7 Å, Crystal structure hASF1A 156-cr17
6ZUF 1.8 Å, Urea-based Foldamer Inhibitor chimera C2 in complex with ASF1 Histone chaperone
6F0H 1.98 Å, Crystal structure ASF1-ip4
9SS3 2.0 Å, Crystal structure hASF1A 156-cr7
6F0F 2.0 Å, Crystal structure ASF1-ip2_s
7LNY 2.1 Å, Apo structure of the Histone chaperone ASF1A residues 1-155
8CJ2 2.13 Å, Urea-based foldamer inhibitor c3u_5 chimera in complex with ASF1 histone chaperone
6F0G 2.3 Å, Crystal structure ASF1-ip3
8CJ1 2.56 Å, Urea-based foldamer inhibitor c3u_3 chimera in complex with ASF1 histone chaperone
2I32 2.7 Å, Structure of a human ASF1a-HIRA complex and insights into specificity of histone…

Browse structure collections

About this viewer

MolViewer shows 8Z50 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.