8Z66: Receptor of hGPR4-Gs complex in pH7.2

Cryo-EM structure of the receptor of hGPR4-Gs complex in pH7.2. Determined by electron microscopy at 3.06 Å resolution. Released 23 Apr 2025.

Method: Electron microscopy
Resolution: 3.06 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,220
Mol. weight: 41.03 kDa
Released: 23 Apr 2025

Explore 8Z66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Z66 contains 15 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-47	34
α-helix	53-77	25
β-strand	82	1	1
α-helix	87-119	33
α-helix	127-129	3
α-helix	131-148	18
α-helix	152-154	3
β-strand	166	1	1
α-helix	177-185	9
α-helix	186-191	6
α-helix	192-209	18
α-helix	216-251	36
α-helix	265-269	5
α-helix	270-275	6
α-helix	278-283	6
α-helix	284-288	5
α-helix	291-303	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein coupled receptor 4	R	protein	362	Homo sapiens	P46093 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>8Z66_1 G-protein coupled receptor 4 (chains R)
MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLS
IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVA
HPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAW
MNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRLALSLIAIVLVCFAPY
HVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKA
LHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPP
AQ

Primary citation

Cryo-EM structure of the receptor of hGPR4-Gs complex in pH7.2. Zhong, Y.N., Guo, L.L. To be published.

Other PDB entries of the same protein (UniProt P46093 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9JCO 2.36 Å, Cryo-EM structure of the proton-sensing GPCR (GPR4)-Gs protein complex at pH 6.5
8Z9O 2.4 Å, Cryo-EM structure of human GPR4-Gs complex
8Z9P 2.5 Å, Cryo-EM structure of human GPR4-Gi complex
9JCP 2.55 Å, Cryo-EM structure of the proton-sensing GPCR (GPR4)-Gq protein complex at pH 7.4
9JCQ 2.59 Å, Cryo-EM structure of the proton-sensing GPCR (GPR4)-Gs protein complex at pH 7.4
9LMP 2.65 Å, Cryo-EM structure of antagonist-bounded inactive human GPR4
9JFV 2.67 Å, Cryo-EM structure of GPR4 complexed with miniGs/q in pH6.8
9IV6 2.71 Å, Cryo-EM structure of hGPR4-Gs complex in pH7.0
8Z3Q 2.76 Å, Cryo-EM structure of the hGPR4-Gs complex in pH7.6
9BIP 2.8 Å, Human proton sensing receptor GPR4 in complex with miniGs
9LGM 2.84 Å, Cryo-EM structure of GPR4 complexed with Gs in pH8.0
9JFX 2.87 Å, Cryo-EM structure of GPR4 complexed with miniGs/q in pH7.5

Browse structure collections

About this viewer

MolViewer shows 8Z66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.