8Z73: AF9
Crystal Structure of AF9 in complex with H3K9la peptide. Determined by X-ray diffraction at 2.91 Å resolution. Released 23 Apr 2025.
- Method
- X-ray diffraction
- Resolution
- 2.91 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 5,003
- Mol. weight
- 79.13 kDa
- Released
- 23 Apr 2025
Explore 8Z73 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8Z73 contains 19 α-helices and 50 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-19 | 14 | 1 |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-46 | 3 | |
| β-strand | 48-54 | 7 | 2 |
| β-strand | 63-66 | 4 | 2 |
| β-strand | 71-77 | 7 | 1 |
| β-strand | 80 | 1 | 3 |
| β-strand | 81-89 | 9 | 2 |
| β-strand | 97-104 | 8 | 2 |
| β-strand | 107 | 1 | 4 |
| α-helix | 108 | 1 | |
| α-helix | 112-113 | 2 | |
| β-strand | 114-125 | 12 | 1 |
| α-helix | 129-137 | 9 | |
Chain B: 4 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-19 | 14 | 5 |
| β-strand | 30-37 | 8 | 5 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-46 | 3 | |
| β-strand | 48-54 | 7 | 6 |
| β-strand | 63-66 | 4 | 6 |
| β-strand | 71-77 | 7 | 5 |
| β-strand | 80 | 1 | 7 |
| β-strand | 81-89 | 9 | 6 |
| β-strand | 97-104 | 8 | 6 |
| β-strand | 107 | 1 | 8 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-125 | 12 | 5 |
| α-helix | 129-135 | 7 | |
Chains C and G: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5 | 1 | 8 |
| α-helix | 6-7 | 2 | |
| β-strand | 8 | 1 | 7 |
Chain D: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-19 | 14 | 9 |
| β-strand | 30-37 | 8 | 9 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-46 | 3 | |
| β-strand | 48-54 | 7 | 10 |
| β-strand | 63-66 | 4 | 10 |
| β-strand | 71-77 | 7 | 9 |
| β-strand | 80 | 1 | 11 |
| β-strand | 81-89 | 9 | 10 |
| β-strand | 97-104 | 8 | 10 |
| β-strand | 107 | 1 | 12 |
| β-strand | 109 | 1 | 13 |
| β-strand | 111 | 1 | 13 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-125 | 12 | 9 |
| α-helix | 129-136 | 8 | |
Chains E and P: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5 | 1 | 12 |
| β-strand | 8 | 1 | 11 |
Chain F: 4 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-19 | 14 | 14 |
| β-strand | 30-37 | 8 | 14 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-46 | 3 | |
| β-strand | 48-54 | 7 | 15 |
| β-strand | 63-66 | 4 | 15 |
| β-strand | 71-77 | 7 | 14 |
| β-strand | 80 | 1 | 16 |
| β-strand | 81-89 | 9 | 15 |
| β-strand | 97-104 | 8 | 15 |
| β-strand | 107 | 1 | 17 |
| α-helix | 108 | 1 | |
| β-strand | 114-125 | 12 | 14 |
| α-helix | 129-136 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein AF-9 | A, B, D, F | protein | 158 | Homo sapiens | P42568 (AlphaFold model) |
| Histone H3.3C | C, E, G, P | protein | 10 | Homo sapiens | Q6NXT2 (AlphaFold model) |
Sequence of entity 1 (A, B, D, F), FASTA
>8Z73_1 Protein AF-9 (chains A, B, D, F)
MGSSHHHHHHSSGLVPRGSHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPE
HSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Sequence of entity 2 (C, E, G, P), FASTA
>8Z73_2 Histone H3.3C (chains C, E, G, P)
ARTKQTARXS
Primary citation
Crystal Structure of AF9 in complex with H3K9la peptide. Ma, H.D., Li, H.T. To be published.
Other PDB entries of the same protein (UniProt P42568 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8PJ7 1.26 Å, MLLT3 in complex with compound PFI-6
- 7VKG 1.83 Å, Crystal structure of AF9 YEATS domain in complex with Compound 10
- 5YYF 1.9 Å, Crystal structure of AF9 YEATS domain in complex with a peptide inhibitor…
- 6MIL 1.93 Å, Crystal structure of AF9 YEATS domain in complex with histone H3K9bu
- 7EIC 1.95 Å, Crystal structure of AF9 YEATS domain in complex with H4K5acK8ac peptide
- 7EID 2.0 Å, Crystal structure of AF9 YEATS domain in complex with H4K8acK12ac peptide
- 8TLX 2.1 Å, Crystal structure of MBP and AF9 AHD fusion protein 3AQA in complex with peptidomimetic…
- 9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…
- 8TLW 2.11 Å, Crystal structure of MBP and AF9 AHD fusion protein 3AQA in complex with peptidomimetic…
- 6LS6 2.2 Å, Crystal Structure of YEATS domain of AF9 in complex with H3K9bz peptide
- 7VKH 2.25 Å, Crystal structure of AF9 YEATS domain in complex with hit 2
- 4TMP 2.3 Å, Crystal structure of AF9 YEATS bound to H3K9ac peptide
Browse structure collections
About this viewer
MolViewer shows 8Z73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.