8Z8L: IL-4Ra

structure of IL-4Ra in complex with an nanobody 4E9. Determined by X-ray diffraction at 3.96 Å resolution. Released 30 Apr 2025.

Method: X-ray diffraction
Resolution: 3.96 Å
Organisms: Homo sapiens, Vicugna pacos
Chains: 2
Atoms: 2,380
Mol. weight: 38.79 kDa
Ligands: NAG
Released: 30 Apr 2025

Explore 8Z8L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Z8L contains 4 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	8
β-strand	10-12	3	9
β-strand	17-24	8	8
β-strand	30-37	8	9
β-strand	40-48	9	9
β-strand	55-57	3	9
β-strand	66-69	4	8
β-strand	75-81	7	8
α-helix	85-87	3
β-strand	89-96	8	9
β-strand	104	1	9
β-strand	109-113	5	9

Chain B: 3 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-11	9	1
β-strand	16-23	8	1
β-strand	33-38	6	2
β-strand	47-49	3	2
β-strand	52-53	2	1
β-strand	58-64	7	1
β-strand	74-80	7	2
β-strand	83-90	8	2
β-strand	96	1	1
α-helix	99-101	3
β-strand	102-106	5	3
β-strand	114-119	6	3
α-helix	128-131	4
β-strand	132	1	4
β-strand	135-139	5	5
β-strand	140	1	6
β-strand	147-151	5	5
β-strand	158-161	4	3
β-strand	172	1	6
β-strand	173-174	2	7
β-strand	175-177	3	5
β-strand	180	1	4
α-helix	188-192	5
β-strand	194-195	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-4 receptor subunit alpha	B	protein	214	Homo sapiens	P24394 (AlphaFold model)
nanobody dAb1	A	protein	124	Vicugna pacos

Sequence of entity 1 (B), FASTA

>8Z8L_1 Interleukin-4 receptor subunit alpha (chains B)
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCV
CHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSN
PYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWA
QAYNTTWSEWSPSTKWHNSYREPFEQHHHHHHHA

Sequence of entity 2 (A), FASTA

>8Z8L_2 nanobody dAb1 (chains A)
QVQLVESGGGLVQPGGSLRLSCAASGDFYCMAWFRQAPGKEREAVAAIRSGGRSTYYADS
VKGRFTISRDNSKNTLYLQMNSLKAEDTAVYYCAVGVDGNCRNYWGQGTLVTVSSESHHH
HHHA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structural insight into interleukin-4R alpha and interleukin-5 inhibition by nanobodies from a bispecific antibody. Qiu, W., Meng, J., Su, Z. et al. MedComm (2020) (2024) 5:e700-e700. DOI 10.1002/mco2.700 · PubMed

Other PDB entries of the same protein (UniProt P24394 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IAR 2.3 Å, Interleukin-4 / receptor alpha chain complex
8K4Q 2.59 Å, Crystal structure of nanobody HuNb103 bound to human interleukin-4 receptor subunit alpha
6WGL 2.82 Å, Dupilumab fab with Crystal Kappa design complexed with human IL-4 receptor
3BPL 2.93 Å, Crystal structure of the IL4-IL4R-Common Gamma ternary complex
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3BPN 3.02 Å, Crystal structure of the IL4-IL4R-IL13Ra ternary complex
6OEL 3.1 Å, Engineered Fab bound to IL-4 receptor
1IRS Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, NMR, minimized average…

Browse structure collections

About this viewer

MolViewer shows 8Z8L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.