8ZLW: RDGC IQ motif/dCaM Complex

Crystal Structure of RDGC IQ motif/dCaM Complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Apr 2025.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Escherichia coli #1/H766, Drosophila melanogaster
Chains: 3
Atoms: 4,219
Mol. weight: 62.36 kDa
Ligands: CA
Released: 2 Apr 2025

Explore 8ZLW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZLW contains 32 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
α-helix	18-31	14
β-strand	36-39	4	1
α-helix	44-51	8
α-helix	52-54	3
β-strand	60-64	5	1
α-helix	65-67	3
α-helix	68-73	6
β-strand	77	1	2
α-helix	78-80	3
α-helix	84-88	5
β-strand	90	1	3
α-helix	92-95	4
α-helix	96-98	3
β-strand	99-100	2	4
β-strand	103-104	2	4
β-strand	107-112	6	1
β-strand	115-119	5	5
β-strand	129	1	6
α-helix	133-141	9
β-strand	146-148	3	5
α-helix	155-164	10
β-strand	171	1	7
β-strand	178	1	7
α-helix	187-201	15
α-helix	211-219	9
β-strand	223-228	6	5
α-helix	230-232	3
α-helix	233-239	7
β-strand	243-246	4	5
α-helix	247-249	3
β-strand	250	1	6
β-strand	251	1	8
β-strand	254	1	8
β-strand	259-260	2	9
β-strand	261-267	7	1
β-strand	268	1	2
α-helix	274-281	8
β-strand	282	1	10
β-strand	286	1	10
α-helix	288-297	10
β-strand	302-303	2	1
β-strand	305	1	3
α-helix	306-312	7
α-helix	316-326	11
β-strand	329-330	2	9
α-helix	331-332	2
α-helix	337-352	16
α-helix	358-367	10

Chain N: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-17	14
β-strand	24-25	2	11
α-helix	27-36	10
α-helix	43-51	9
β-strand	61-62	2	11
α-helix	63-71	9
α-helix	79-90	12
β-strand	98	1	12
α-helix	100-110	11
α-helix	116-126	11
β-strand	134	1	12
α-helix	136-145	10

Chain R: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2B-16	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltodextrin-binding protein	A	protein	376	Escherichia coli #1/H766	A0ACD6BAW2
Calmodulin	N	protein	153	Drosophila melanogaster	P62152 (AlphaFold model)
Serine/threonine-protein phosphatase rdgC	R	protein	33	Drosophila melanogaster	P40421 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ZLW_1 Maltodextrin-binding protein (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAARAFAAA

Sequence of entity 2 (N), FASTA

>8ZLW_2 Calmodulin (chains N)
GPGSMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV
DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEK
LTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK

Sequence of entity 3 (R), FASTA

>8ZLW_3 Serine/threonine-protein phosphatase rdgC (chains R)
MDENAIRAAIFIQKWYRRHQARREMLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structural insights into the dual Ca 2+ -sensor-mediated activation of the PPEF phosphatase family. Liu, J., Wu, C., Liu, Y. et al. Nat Commun (2025) 16:3120-3120. DOI 10.1038/s41467-025-58261-z · PubMed

Other PDB entries of the same protein (UniProt A0ACD6BAW2), best resolution first:

7KD5 1.55 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
6ZIS 1.73 Å, Crystal structure of a CGRP receptor ectodomain heterodimer with bound high affinity…
5GXT 2.25 Å, Crystal structure of PigG
8R3E 2.91 Å, Huntingtin, 1-17, MBP-N
8R2O 3.23 Å, Huntingtin-Q17, 1-66, N-MBP fusion
28QM 3.4 Å, MBP bound to distal DARPin (AHIR dodecamer scaffold system)

Browse structure collections

About this viewer

MolViewer shows 8ZLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.