8ZVY: Histone H2B 1.1,Histone H2A type 1

Alpha-Synuclein with H2a-H2b dimer complex structure. Determined by X-ray diffraction at 1.72 Å resolution. Released 28 May 2025.

Method: X-ray diffraction
Resolution: 1.72 Å
Organisms: Xenopus laevis, Homo sapiens
Chains: 4
Atoms: 3,284
Mol. weight: 45.85 kDa
Released: 28 May 2025

Explore 8ZVY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZVY contains 18 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	39-49	11
β-strand	54-55	2	1
α-helix	57-84	28
β-strand	89-90	2	2
α-helix	92-102	11
α-helix	105-122	18
α-helix	1019-1022	4
α-helix	1028-1037	10
β-strand	1043-1044	2	2
α-helix	1047-1073	27
β-strand	1078-1079	2	1
α-helix	1081-1089	9
α-helix	1092-1100	9

Chain B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	39-49	11
β-strand	54-55	2	3
α-helix	57-82	26
β-strand	89-90	2	4
α-helix	92-102	11
α-helix	106-122	17
α-helix	1018-1022	5
α-helix	1028-1037	10
β-strand	1043-1044	2	4
α-helix	1047-1073	27
β-strand	1078-1079	2	3
α-helix	1081-1089	9
α-helix	1092-1098	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2B 1.1,Histone H2A type 1	A, B	protein	186	Xenopus laevis	P02281 (AlphaFold model), P06897 (AlphaFold model)
Isoform 1 of Alpha-synuclein	C, D	protein	20	Homo sapiens	P37840 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8ZVY_1 Histone H2B 1.1,Histone H2A type 1 (chains A, B)
GRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITS
REIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAKKAKTRSSRAGLQFPVGRVHRLLRKGN
YAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLG
GVTIAQ

Sequence of entity 2 (C, D), FASTA

>8ZVY_2 Isoform 1 of Alpha-synuclein (chains C, D)
DNEAYEMPSEEGYQDYEPEA

Primary citation

Structural and functional insights into the nuclear role of Parkinson's disease-associated alpha-synuclein as a histone chaperone. Jos, S., Kambaru, A., Prasad, T.K. et al. Commun Biol (2025) 8:712-712. DOI 10.1038/s42003-025-08138-0 · PubMed

Other PDB entries of the same protein (UniProt P02281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W4L 1.31 Å, The crystal structure of a single chain H2B-H2A histone chimera from Xenopus laevis
1KX5 1.94 Å, X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
1KX3 2.0 Å, X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
1S32 2.05 Å, Molecular Recognition of the Nucleosomal 'Supergroove'
3UTA 2.07 Å, Crystal Structure of Nucleosome Core Particle Assembled with an Alpha-Satellite Sequence…
3UT9 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with a Palindromic Widom '601'…
3UTB 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with the 146b Alpha-Satellite…
6WZ5 2.2 Å, Bridging of double-strand DNA break activates PARP2/HPF1 to modify chromatin
8RUQ 2.29 Å, Borealin N-terminus in complex with H3.T3p-nucleosome
1M19 2.3 Å, Ligand binding alters the structure and dynamics of nucleosomal DNA
1P3I 2.3 Å, Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3MGR 2.3 Å, Binding of Rubidium ions to the Nucleosome Core Particle

Browse structure collections

About this viewer

MolViewer shows 8ZVY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.