8ZXH: Red fluorescent protein mScarlet3-H at pH 4.5

Name: PDB 8ZXH: Structure of the red fluorescent protein mScarlet3-H at pH 4.5
Published: 2025-02-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Structure of the red fluorescent protein mScarlet3-H at pH 4.5. Determined by X-ray diffraction at 1.46 Å resolution. Released 19 Feb 2025.

Method: X-ray diffraction
Resolution: 1.46 Å
Organism: Discosoma sp.
Chains: 1
Atoms: 1,934
Mol. weight: 24.81 kDa
Released: 19 Feb 2025

Explore 8ZXH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZXH contains 8 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	13-23	11	1
β-strand	26-37	12	1
β-strand	42-51	10	1
α-helix	53	1
α-helix	55	1
α-helix	59-61	3
α-helix	63-65	3
α-helix	71-73	3
β-strand	75	1	1
α-helix	83-86	4
β-strand	92-100	9	1
β-strand	105-115	11	1
β-strand	118-128	11	1
β-strand	141-144	4	1
α-helix	145-146	2
β-strand	147-154	8	1
β-strand	157-168	12	1
β-strand	173-184	12	1
α-helix	189-191	3
β-strand	194-205	12	1
β-strand	211-221	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
red fluorescent protein mYongHong	A	protein	215	Discosoma sp.	Q9U6Y8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ZXH_1 red fluorescent protein mYongHong (chains A)
AVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLRVTKGGPLPFSWDILSPQF
XSRAFTKHPADIPDYWKQSFPEGFKWERVMNFEDGGAVSVAQDTSLEDGTLIYKVKLRGT
NFPPDGPVMQKKTMGWEASTERLYPEDVVLKGDIKHALRLKDGGRYLADFKTTYRAKKPV
QMPGAFNIDRKLDITSHNEDYTVVEQYERSVARHS

Primary citation

A highly stable monomeric red fluorescent protein for advanced microscopy. Xiong, H., Chang, Q., Ding, J. et al. Nat Methods (2025) 22:1288-1298. DOI 10.1038/s41592-025-02676-5 · PubMed

Other PDB entries of the same protein (UniProt Q9U6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H5O 1.08 Å, Crystal structure of mOrange
8B7G 1.3 Å, Structure of oxygen-degraded rsCherry
7ZCT 1.33 Å, Structure of the red fluorescent protein mScarlet3 at pH 7.5
9LSC 1.38 Å, Crystal structure of mRFP1 with a grafted calcium-binding sequence and two bound calcium…
1ZGO 1.4 Å, High Resolution Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed)
7OIN 1.4 Å, Crystal structure of LSSmScarlet - a genetically encoded red fluorescent protein with a…
8ARM 1.41 Å, Crystal structure of LSSmScarlet2
5LK4 1.47 Å, Structure of the Red Fluorescent Protein mScarlet at pH 7.8
8B65 1.55 Å, Structure of rsCherry crystallized in anaerobic conditions
2VAD 1.59 Å, Monomeric red fluorescent protein, DsRed.M1
2H5R 1.6 Å, Crystal structure of mStrawberry at pH 10.5
9LSA 1.62 Å, Crystal structure of mRFP1 with a grafted calcium-binding sequence and one bound calcium…

Browse structure collections

About this viewer

MolViewer shows 8ZXH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.