9B4T: MRAS-p110alpha complex

Crystal structure of the MRAS-p110alpha complex. Determined by X-ray diffraction at 2.75 Å resolution. Released 22 Jan 2025.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,714
Mol. weight: 133.35 kDa
Ligands: GNP, MG, 5H5
Released: 22 Jan 2025

Explore 9B4T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B4T contains 57 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 50 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	108-121	14
α-helix	126-129	4
α-helix	134-142	9
α-helix	144-155	12
α-helix	158-166	9
β-strand	171	1	1
α-helix	179-182	4
β-strand	186	1	2
β-strand	189-197	9	2
β-strand	204-212	9	2
α-helix	217-228	12
α-helix	236-246	11
β-strand	250-254	5	2
β-strand	260-261	2	2
α-helix	267-269	3
β-strand	270	1	1
α-helix	271-278	8
β-strand	284-289	6	2
α-helix	290-295	6
α-helix	298-300	3
α-helix	306-308	3
β-strand	325-326	2	3
α-helix	327-329	3
β-strand	333-340	8	4
β-strand	354-357	4	5
β-strand	360-361	2	5
β-strand	366	1	5
β-strand	372	1	5
β-strand	376	1	5
β-strand	382-392	11	4
α-helix	393-395	3
β-strand	401-409	9	5
β-strand	419-428	10	5
β-strand	430	1	6
β-strand	435	1	3
β-strand	436	1	6
α-helix	437	1
β-strand	439-442	4	4
β-strand	446-447	2	5
β-strand	474-477	4	4
β-strand	484-485	2	3
α-helix	486-488	3
α-helix	489-498	10
α-helix	527-536	10
α-helix	545-553	9
α-helix	557-560	4
α-helix	562-564	3
α-helix	565-571	7
α-helix	578-588	11
α-helix	590-592	3
α-helix	595-598	4
α-helix	599-602	4
α-helix	609-622	14
α-helix	625-630	6
α-helix	632-637	6
α-helix	648-657	10
α-helix	661-673	13
α-helix	674-676	3
α-helix	681-694	14
α-helix	698-722	25
α-helix	728-740	13
α-helix	742-747	6
β-strand	751-753	3	7
β-strand	756-761	6	7
β-strand	764	1	8
α-helix	766-768	3
β-strand	770-771	2	8
β-strand	779-784	6	8
α-helix	790-792	3
β-strand	796-803	8	8
α-helix	808-827	20
β-strand	838-840	3	8
β-strand	845-849	5	8
α-helix	850-851	2
β-strand	854-856	3	9
α-helix	857-862	6
α-helix	876-884	9
α-helix	890-911	22
α-helix	915-916	2
β-strand	921-924	4	9
β-strand	929-931	3	9
α-helix	958-964	7
α-helix	975-992	18
α-helix	995-1003	9
α-helix	1016-1025	10
α-helix	1032-1047	16

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	13-19	7	2
α-helix	26-35	10
β-strand	48-56	9	2
β-strand	59-67	9	2
α-helix	78-84	7
β-strand	87-93	7	2
α-helix	97-101	5
α-helix	103-114	12
β-strand	121-126	6	2
α-helix	131-133	3
α-helix	138-147	10
β-strand	152-154	3	2
α-helix	164-177	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	A	protein	965	Homo sapiens	P42336 (AlphaFold model)
Ras-related protein M-Ras	B	protein	179	Homo sapiens	O14807 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9B4T_1 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (chains A)
GVGNREEKILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRA
MYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAE
AIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMP
NLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATY
VNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLC
LSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTG
SNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNEL
RENDKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQM
YCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQ
YLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLN
RQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGN
LRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENI
WQNQGLDLRMLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKD
KNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKK
KFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFS
MMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDAAAHTIK
QHALN

Sequence of entity 2 (B), FASTA

>9B4T_2 Ras-related protein M-Ras (chains B)
GMATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFAKIFVPDYDPTIEDSYLKHTEIDNQ
WAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESF
PMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQ

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1
5H5	(2S)-2-({2-[1-(propan-2-yl)-1H-1,2,4-triazol-5-yl]-5,6-dihydroimidazo[1,2-d][1,…	C19 H22 N6 O3	1

Primary citation

Structural insights into isoform-specific RAS-PI3K alpha interactions and the role of RAS in PI3K alpha activation. Czyzyk, D., Yan, W., Messing, S. et al. Nat Commun (2025) 16:525-525. DOI 10.1038/s41467-024-55766-x · PubMed

Other PDB entries of the same protein (UniProt P42336 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CMK 1.75 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASF 1.77 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide analogue…
9CX0 1.92 Å, Crystal structure of HLA-A*03:01 E152V mutant in complex with a mutant PIK3CA peptide
7L1C 1.96 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide
9CWY 1.98 Å, Crystal structure of HLA-A*03:02 in complex with a wild-type PIK3CA peptide
8EXL 1.99 Å, Crystal structure of PI3K-alpha in complex with taselisib
9CX1 2.0 Å, Crystal structure of HLA-A*03:01 L156Q mutant in complex with a mutant PIK3CA peptide
9CML 2.01 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASG 2.03 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide analogue (Trp-6…
7L1B 2.04 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide
9CWZ 2.05 Å, Crystal structure of HLA-A*03:02 in complex with a mutant PIK3CA peptide
7JIU 2.12 Å, Human PI3KDELTA in complex with compound 2F

Browse structure collections

About this viewer

MolViewer shows 9B4T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.