9B9I: Type 1 encapsulin shell protein EncA

Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry. Determined by electron microscopy at 2.86 Å resolution. Released 18 Sept 2024.

Method: Electron microscopy
Resolution: 2.86 Å
Organism: Myxococcus xanthus DK 1622
Chains: 1
Atoms: 2,038
Mol. weight: 30.9 kDa
Released: 18 Sept 2024

Explore 9B9I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9B9I contains 9 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	14-31	18
α-helix	34-36	3
β-strand	39-43	5	1
β-strand	50-52	3	2
β-strand	82-84	3	2
α-helix	85-86	2
β-strand	87-94	8	1
α-helix	96-105	10
α-helix	108-110	3
α-helix	112-130	19
β-strand	148-149	2	3
α-helix	160-173	14
β-strand	181-185	5	3
α-helix	187-190	4
β-strand	209-212	4	3
β-strand	221-225	5	3
β-strand	231-243	13	1
β-strand	251-263	13	1
α-helix	266-268	3
β-strand	269-271	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Type 1 encapsulin shell protein EncA	A	protein	281	Myxococcus xanthus DK 1622	Q1D6H4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9B9I_1 Type 1 encapsulin shell protein EncA (chains A)
MPDFLGHAENPLREEEWARLNETVIQVARRSLVGRRILDIYGPLGAGVQTVPYDEFQGVS
PGAVDIVGEQETAMVFTDARKFKTIPIIYKDFLLHWRDIEAARTHNMPLDVSAAAGAAAL
CAQQEDELIFYGDARLGYEGLMTANGRLTVPLGDWTSPGGGFQAIVEATRKLNEQGHFGP
YAVVLSPRLYSQLHRGGEIETIRQLASDGVYQSNRLRGESGVVVSTGRENMDLAVSMDMV
AAYLGASRMNHPFRVLEALLLRIKHPDAICTLEGAGATERR

Primary citation

Pore Engineering as a General Strategy to Improve Protein-Based Enzyme Nanoreactor Performance. Kwon, S., Andreas, M.P., Giessen, T.W. ACS Nano (2024) 18:25740-25753. DOI 10.1021/acsnano.4c08186 · PubMed

Other PDB entries of the same protein (UniProt Q1D6H4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJO 2.4 Å, Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo
8V4N 2.43 Å, Myxococcus xanthus EncA 3xHis pore mutant with T=1 icosahedral symmetry
8TK7 2.53 Å, Myxococcus xanthus EncA protein shell with compartmentalized SNAP-tag cargo protein
8V4Q 2.71 Å, Myxococcus xanthus EncA 3xHis pore mutant with tetrahedral symmetry
7S4Q 3.12 Å, M. xanthus encapsulin EncA bound to EncC targeting peptide
9B9Q 3.14 Å, Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3…
7S20 3.4 Å, M. xanthus encapsulin shell protein EncA with T=3 symmetry
7S21 3.4 Å, M. xanthus encapsulin shell protein EncA with T=1 symmetry
7S2T 3.45 Å, M. xanthus encapsulin EncA bound to EncB targeting peptide
9BC8 3.46 Å, Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4…
4PT2 4.6 Å, Myxococcus xanthus encapsulin protein (EncA)

Browse structure collections

About this viewer

MolViewer shows 9B9I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.