9BJG: Apical membrane antigen 1

Crystal structure of broadly neutralizing human monoclonal antibody 75B10 in complex with AMA1. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Mar 2025.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Plasmodium falciparum 3D7, Homo sapiens
Chains: 3
Atoms: 5,593
Mol. weight: 89.97 kDa
Released: 12 Mar 2025

Explore 9BJG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BJG contains 27 α-helices and 72 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	113-117	5
α-helix	119-122	4
β-strand	129	1	1
β-strand	133-137	5	2
β-strand	140-144	5	2
β-strand	151-152	2	3
β-strand	154-157	4	4
β-strand	168	1	5
α-helix	169-170	2
β-strand	182	1	5
α-helix	183-185	3
β-strand	193-194	2	3
α-helix	195-201	7
α-helix	206-208	3
α-helix	213-222	10
β-strand	238-241	4	3
β-strand	246-249	4	3
β-strand	250	1	5
β-strand	257	1	6
β-strand	276	1	6
β-strand	277-280	4	4
β-strand	287-290	4	3
α-helix	298-301	4
β-strand	306	1	7
β-strand	307-308	2	8
β-strand	311-316	6	9
β-strand	319-322	4	9
β-strand	327-330	4	8
α-helix	334-344	11
β-strand	347	1	1
β-strand	399-403	5	8
β-strand	408-412	5	8
β-strand	418-420	3	9
β-strand	425-429	5	8
β-strand	437	1	7

Chain H: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	10
β-strand	11-12	2	11
β-strand	18-25	8	10
α-helix	29-31	3
β-strand	33-39	7	12
β-strand	45-51	7	12
β-strand	58-60	3	12
β-strand	68-73	6	10
α-helix	74-76	3
β-strand	78-83	6	10
α-helix	88-90	3
β-strand	92-99	8	12
β-strand	101-106	6	13
β-strand	111-115	5	13
β-strand	118-119	2	12
β-strand	123-125	3	12
β-strand	126-127	2	11
α-helix	131-132	2
β-strand	133	1	14
α-helix	134-135	2
β-strand	136-140	5	15
β-strand	147-148	2	15
β-strand	151-161	11	15
β-strand	162	1	14
α-helix	165	1
β-strand	169-170	2	16
α-helix	171-173	3
β-strand	180-181	2	15
α-helix	182-184	3
β-strand	185-186	2	15
β-strand	192-201	10	15
α-helix	202-204	3
β-strand	210-216	7	16
α-helix	217-219	3
β-strand	221-227	7	16

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	17
β-strand	10-13	4	18
β-strand	19-25	7	17
β-strand	33-38	6	18
β-strand	45-49	5	18
β-strand	53-54	2	18
α-helix	55	1
β-strand	62-67	6	17
β-strand	70-75	6	17
α-helix	80-82	3
β-strand	85-90	6	18
α-helix	96	1
β-strand	97-98	2	18
β-strand	102-106	5	18
β-strand	111	1	19
β-strand	114-118	5	20
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	20
β-strand	140	1	19
β-strand	145-150	6	21
β-strand	153-154	2	21
β-strand	159-163	5	20
α-helix	164-167	4
β-strand	173-182	10	20
α-helix	183-186	4
β-strand	191-197	7	21
β-strand	205-210	6	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apical membrane antigen 1	A	protein	347	Plasmodium falciparum 3D7	P22621 (AlphaFold model)
75B10 Fab Heavy Chain	H	protein	247	Homo sapiens
75B10 Fab Light Chain	L	protein	217	Homo sapiens

Sequence of entity 1 (A), FASTA

>9BJG_1 Apical membrane antigen 1 (chains A)
ETGNYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIEN
SNTAFLTPVATGNQYLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRH
AGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAK
DISFQNYAYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKL
VFELSASDQPKQYEQHLTDYEKIKEGFKNKNAAMIKSAFLPTGAFKADRYKSHGKGYNWG
NYNTETQKCEIFNVKPTCLINNAAYIATTALSHPIEVEGTKHHHHHH

Sequence of entity 2 (H), FASTA

>9BJG_2 75B10 Fab Heavy Chain (chains H)
MGIQVQLVQSGGGLVKPGGSLIISCEGSGYRFSDYHMSWIRQVPGKGMEWVADITTKGDQ
TAYADSVRGRFTVSRDNAKNSMFLQMNGLKVEDTAVYFCGRDRFRGGYNYPSDIYSHAPD
HWGQGQLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGG
SHHHHHH

Sequence of entity 3 (L), FASTA

>9BJG_3 75B10 Fab Light Chain (chains L)
MGIDIQMTQSPSTLSASVGDRVTITCRASQTINNWLAWYQQKPGRAPKVLIYAASDLDSG
VPSRFSASGSGTHFSLTISSLQPDDFATYFCQQYNEFPVTFGQGTKLELKRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS
TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

A strain-transcending anti-AMA1 human monoclonal antibody neutralizes malaria parasites independent of direct RON2L receptor blockade. Patel, P.N., Diouf, A., Dickey, T.H. et al. Cell Rep Med (2025) 6:101985-101985. DOI 10.1016/j.xcrm.2025.101985 · PubMed

Other PDB entries of the same protein (UniProt P22621 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q8B 2.3 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
2Q8A 2.4 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
9BJH 2.8 Å, Crystal structure of neutralizing human monoclonal antibody 75C8 in complex with AMA1…
1YXE Structure and inter-domain interactions of domain II from the blood stage malarial…

Browse structure collections

About this viewer

MolViewer shows 9BJG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.