9BPU: Interferon lambda-4

Structure of the IFN-lambda4/IFN-lambdaR1/IL-10Rbeta receptor complex with an engineered IL-10Rbeta. Determined by electron microscopy at 3.26 Å resolution. Released 29 Jan 2025.

Method: Electron microscopy
Resolution: 3.26 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,318
Mol. weight: 68.63 kDa
Released: 29 Jan 2025

Explore 9BPU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BPU contains 25 α-helices and 40 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
β-strand	25-32	8	1
β-strand	35-41	7	1
β-strand	51-58	8	2
β-strand	61-69	9	2
β-strand	73-75	3	1
β-strand	85-93	9	2
β-strand	96-97	2	2
β-strand	101-105	5	2
α-helix	107-110	4
β-strand	112	1	1
α-helix	113-116	4
β-strand	117-123	7	3
β-strand	126-132	7	3
α-helix	133-134	2
β-strand	135	1	4
α-helix	136	1
β-strand	144	1	4
α-helix	145-148	4
β-strand	153-160	8	5
β-strand	167-169	3	5
β-strand	175-178	4	3
α-helix	181-182	2
β-strand	186-195	10	5
β-strand	200-201	2	5
α-helix	204-206	3
β-strand	208-211	4	5
α-helix	212-213	2

Chain B: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	6
β-strand	11-15	5	7
β-strand	18-22	5	7
β-strand	25	1	6
β-strand	34-41	8	8
α-helix	49	1
β-strand	50	1	8
α-helix	51	1
β-strand	57	1	8
β-strand	61-63	3	7
β-strand	76-83	8	8
β-strand	88	1	8
α-helix	89-91	3
β-strand	92-93	2	8
β-strand	97	1	8
α-helix	99-102	4
α-helix	103-105	3
β-strand	109-114	6	9
β-strand	118-124	7	9
β-strand	137-144	8	10
β-strand	151-152	2	10
α-helix	153-155	3
β-strand	156	1	10
β-strand	163-165	3	9
β-strand	172-183	12	10
β-strand	187-189	3	10
α-helix	192-195	4
β-strand	198-200	3	10

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	24-27	4
α-helix	29-32	4
α-helix	37-57	21
α-helix	67-71	5
α-helix	75-98	24
α-helix	106-126	21
α-helix	150-163	14
α-helix	164-168	5
α-helix	169-175	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon lambda-4	C	protein	175	Homo sapiens	K9M1U5 (AlphaFold model)
Interleukin-10 receptor subunit beta	A	protein	212	Homo sapiens	Q08334 (AlphaFold model)
Interferon lambda receptor 1	B	protein	209	Homo sapiens	Q8IU57 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9BPU_1 Interferon lambda-4 (chains C)
GGGSGAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSS
CARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVP
GAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCLAAAHHHHHHHH

Sequence of entity 2 (A), FASTA

>9BPU_2 Interleukin-10 receptor subunit beta (chains A)
GSMVPPPENVRMNSVNFKNILQWESPAFAKGQLTFTAQYLSYRIFQDKCMQTTLTECDFS
SLSKYGDHTLRVRAEFADEHSDWVQITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIE
NEYETWTMKDMYNSWTYNVQYWKQGTDEKFQITPQYDFEVLRNLEPRTTYCVQVRGFLPD
RNKAGEWSEPVCEQTTHDETVPSAAAHHHHHH

Sequence of entity 3 (B), FASTA

>9BPU_3 Interferon lambda receptor 1 (chains B)
RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKEL
LCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILS
ANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSART
IYTFSVPKYSKFSKPTCFLLEVPEANAAA

Primary citation

Structural studies of the IFN lambda 4 receptor complex using cryoEM enabled by protein engineering. Grubbe, W.S., Zhang, B., Kauffman, A. et al. Nat Commun (2025) 16:818-818. DOI 10.1038/s41467-025-56119-y · PubMed

Browse structure collections

About this viewer

MolViewer shows 9BPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.