9C4B: Second BAF53a of the human TIP60 complex

Second BAF53a of the human TIP60 complex. Determined by electron microscopy at 3.4 Å resolution. Released 14 Aug 2024.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,080
Mol. weight: 47.51 kDa
Released: 14 Aug 2024

Explore 9C4B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9C4B contains 22 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	1
β-strand	22-27	6	1
β-strand	35-38	4	1
β-strand	41	1	2
β-strand	42	1	3
β-strand	69	1	3
α-helix	71-76	6
β-strand	85	1	2
α-helix	96-105	10
α-helix	106-110	5
β-strand	120-124	5	1
α-helix	130-138	9
α-helix	139-143	5
β-strand	148-153	6	1
α-helix	154-162	9
β-strand	167-172	6	4
β-strand	177-183	7	4
β-strand	186-187	2	4
α-helix	189-191	3
β-strand	193-195	3	4
α-helix	199-209	11
β-strand	223	1	5
α-helix	229-230	2
β-strand	239	1	5
α-helix	244-247	4
α-helix	248-266	19
β-strand	268	1	6
α-helix	300-303	4
α-helix	305-308	4
α-helix	325-335	11
α-helix	341-344	4
β-strand	348-350	3	4
α-helix	353-355	3
β-strand	358	1	6
α-helix	360-371	12
β-strand	380	1	4
α-helix	386-390	5
α-helix	392-402	11
α-helix	406-409	4
β-strand	411-412	2	1
α-helix	413-418	6
α-helix	423-427	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-like protein 6A	A	protein	429	Homo sapiens	O96019 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9C4B_1 Actin-like protein 6A (chains A)
MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDK
GKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPV
LMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAI
PVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRK
EKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAE
RLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSF
TDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP

Primary citation

Structural insights into the human NuA4/TIP60 acetyltransferase and chromatin remodeling complex. Yang, Z., Mameri, A., Cattoglio, C. et al. Science (2024) 385:eadl5816-eadl5816. DOI 10.1126/science.adl5816 · PubMed

Other PDB entries of the same protein (UniProt O96019 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9UXC 2.74 Å, The ADP-bound structure of BCL7B-containing ARP module of the human SWI/SNF complex
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
9WBZ 2.9 Å, The structure of NCP-motor-ARP module of ncBAF-nucleosome complex
9UXB 2.92 Å, The apo structure of BCL7B-containing ARP module of the human SWI/SNF complex
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex
9UXA 3.28 Å, local ARP-NCP structure of the ncBAF-nucleosome complex in the apo state
9C6N 3.29 Å, ARP module of the human TIP60 complex

Browse structure collections

About this viewer

MolViewer shows 9C4B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.