9C9C: Protein receptor

Protein receptor. Determined by X-ray diffraction at 1.66 Å resolution. Released 27 Aug 2025.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,644
Mol. weight: 47.33 kDa
Ligands: CA
Released: 27 Aug 2025

Explore 9C9C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9C9C contains 14 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10-14	5	1
β-strand	19-20	2	2
β-strand	25-30	6	1
β-strand	37-43	7	3
β-strand	51-52	2	3
α-helix	53-54	2
α-helix	55-57	3
β-strand	59	1	1
β-strand	62-65	4	1
α-helix	70-72	3
β-strand	74-82	9	3
β-strand	85-86	2	3
α-helix	87-92	6
β-strand	93-95	3	3
β-strand	97-98	2	2
β-strand	105-109	5	4
β-strand	113	1	5
α-helix	114-115	2
β-strand	120-130	11	4
β-strand	132-137	6	6
β-strand	145-149	5	6
β-strand	156-163	8	4
β-strand	172-179	8	6
β-strand	186	1	2
β-strand	187	1	6
α-helix	189-193	5
β-strand	194-196	3	6
β-strand	197	1	5

Chain B: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10-14	5	7
β-strand	18-20	3	8
β-strand	25-30	6	7
β-strand	37-43	7	9
β-strand	50-52	3	9
α-helix	53-54	2
α-helix	55-57	3
β-strand	58-59	2	7
β-strand	62-65	4	7
α-helix	70-72	3
β-strand	74-82	9	9
β-strand	85-86	2	9
α-helix	87-92	6
β-strand	93-95	3	9
β-strand	96-98	3	8
β-strand	105-109	5	10
β-strand	113	1	11
β-strand	120-130	11	10
β-strand	132-137	6	12
β-strand	146-148	3	12
α-helix	149-151	3
β-strand	156-163	8	10
β-strand	173-179	7	12
β-strand	186	1	8
β-strand	187	1	12
α-helix	189-193	5
β-strand	194-195	2	12
β-strand	197	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukocyte immunoglobulin-like receptor subfamily B member 2	A, B	protein	211	Homo sapiens	Q8N423 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9C9C_1 Leukocyte immunoglobulin-like receptor subfamily B member 2 (chains A, B)
MQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKN
GQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRV
TLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYD
LNSPYVWSSPSDLLELLVPGGSGSGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (CL, IMD) are not listed.

Primary citation

Protein complex. MacLachlan, B. To be published.

Other PDB entries of the same protein (UniProt Q8N423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2GW5 1.8 Å, Crystal Structure of LIR-2 (ILT4) at 1.8 : differences from LIR-1 (ILT2) in regions…
6BCS 2.1 Å, LilrB2 D1D2 domains complexed with benzamidine
2DYP 2.5 Å, Crystal Structure of LILRB2(LIR2/ILT4/CD85d) complexed with HLA-G
4LLA 2.5 Å, Crystal structure of D3D4 domain of the LILRB2 molecule
9C9D 2.9 Å, Protein receptor
6AED 3.8 Å, Crystal Structure of the four Ig-like domain of LILRB2(LIR2/ILT4/CD85d)

Browse structure collections

About this viewer

MolViewer shows 9C9C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.