9CHV: PDB entry 9CHV

cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in apo state. Determined by electron microscopy at 3.95 Å resolution. Released 13 Nov 2024.

Method: Electron microscopy
Resolution: 3.95 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 6,644
Mol. weight: 106.71 kDa
Ligands: FK5
Released: 13 Nov 2024

Explore 9CHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CHV contains 51 α-helices and 29 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	34-60	27
α-helix	71-77	7
α-helix	81-84	4
α-helix	86-96	11
α-helix	103-114	12
α-helix	117-136	20
α-helix	138-144	7
α-helix	147-171	25
α-helix	198-203	6
α-helix	204-209	6
α-helix	210-214	5
α-helix	218-224	7
α-helix	227-230	4
α-helix	237-245	9
β-strand	253-254	2	1
α-helix	255-258	4
α-helix	271-277	7
β-strand	284-285	2	1
α-helix	287-295	9
α-helix	303-314	12
β-strand	322	1	2
α-helix	326-335	10
α-helix	341-355	15
β-strand	363	1	2
α-helix	365-372	8
α-helix	378-380	3
α-helix	391-393	3
α-helix	401-407	7
α-helix	410-420	11
α-helix	430-434	5
α-helix	437-444	8
α-helix	447-451	5
α-helix	453-460	8

Chain B: 20 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
α-helix	26-27	2
β-strand	28	1	3
β-strand	34	1	4
α-helix	39	1
β-strand	40	1	4
α-helix	41	1
α-helix	43-49	7
β-strand	55	1	3
α-helix	57-72	16
β-strand	84	1	5
β-strand	85-86	2	6
α-helix	94-103	10
β-strand	112-113	2	6
α-helix	125-138	14
α-helix	154-158	5
α-helix	162-168	7
α-helix	171-181	11
β-strand	189-190	2	7
β-strand	194-196	3	7
α-helix	208-212	5
α-helix	225-229	5
α-helix	248	1
β-strand	249	1	8
α-helix	250	1
β-strand	257	1	8
α-helix	261-270	10
β-strand	276-278	3	7
β-strand	287-288	2	7
α-helix	291	1
β-strand	292	1	9
α-helix	293	1
β-strand	299	1	9
β-strand	301-304	4	7
α-helix	310-312	3
β-strand	319-324	6	5
β-strand	327-332	6	5
α-helix	348-368	21

Chain C: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	10
β-strand	21-25	5	11
β-strand	46-49	4	11
α-helix	57-62	6
α-helix	63-65	3
β-strand	71	1	11
β-strand	75-76	2	10
β-strand	97	1	10
β-strand	102-105	4	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2 adrenergic receptor,Calcineurin subunit B type 1	A	protein	449	Homo sapiens	P07550 (AlphaFold model), P63098 (AlphaFold model)
Protein phosphatase 3 catalytic subunit alpha	B	protein	370	Mus musculus	P63328 (AlphaFold model)
Peptidyl-prolyl cis-trans isomerase FKBP1A	C	protein	108	Homo sapiens	P62942 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9CHV_1 Beta-2 adrenergic receptor,Calcineurin subunit B type 1 (chains A)
DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVP
FGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKN
KARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVSF
YVPLVIMVFVYSRVFQEAKRQLDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNP
LVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELF
QVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDVKFC
LKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNSGFNPLI
YCRSPDFRIAFQELLCLRRDDLKAYGNGY

Sequence of entity 2 (B), FASTA

>9CHV_2 Protein phosphatase 3 catalytic subunit alpha (chains B)
SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVA
LRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVD
RGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDA
FDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGN
EKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV
TEMLVNVLNI

Sequence of entity 3 (C), FASTA

>9CHV_3 Peptidyl-prolyl cis-trans isomerase FKBP1A (chains C)
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Ligands and cofactors

ID	Name	Formula	Copies
FK5	8-deethyl-8-[but-3-enyl]-ascomycin	C44 H69 N O12	1

Primary citation

Calcineurin-fusion facilitates cryo-EM structure determination of a Family A GPCR. Xu, J., Chen, G., Wang, H. et al. Proc Natl Acad Sci U S A (2024) 121:e2414544121-e2414544121. DOI 10.1073/pnas.2414544121 · PubMed

Other PDB entries of the same protein (UniProt P07550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GQ4 1.9 Å, Structural determinants of the nherf interaction with BETA2AR and pdgfr
2RH1 2.4 Å, High resolution crystal structure of human B2-adrenergic G protein-coupled receptor.
6PS2 2.4 Å, XFEL beta2 AR structure by ligand exchange from Timolol to Alprenolol.
9WG6 2.44 Å, D1R-Gs in complexed with Dopamine/LY3154207/BMSA1/UNC9815
9RKF 2.45 Å, Dark structure of beta-2 Adrenergic receptor with photoazolol in Dark state recorded at…
9RKG 2.45 Å, Mixed model refinement of beta-2 Adrenergic receptor with photoazolol in dark state and…
5D5A 2.48 Å, In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic receptor…
6PS3 2.5 Å, XFEL beta2 AR structure by ligand exchange from Timolol to Carvedilol.
9Q3L 2.5 Å, CryoEM structure of beta2-adrenergic receptor dimer mediated by a biased allosteric…
9RKH 2.5 Å, Dark structure of beta-2 Adrenergic receptor with photoazolol in Dark state recorded at…
9WG0 2.59 Å, D1R-Gs in complexed with SKF81297/LY3154207/BMSA1/UNC10062
6PS4 2.6 Å, XFEL beta2 AR structure by ligand exchange from Timolol to ICI-118551.

Browse structure collections

About this viewer

MolViewer shows 9CHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.