9CI8: T cell receptor complex

T cell receptor complex. Determined by electron microscopy at 3.01 Å resolution. Released 31 Jul 2024.

Method: Electron microscopy
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 12
Atoms: 10,466
Mol. weight: 163.3 kDa
Released: 31 Jul 2024

Explore 9CI8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CI8 contains 33 α-helices and 114 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	31-54	24

Chain A: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	11	1	2
β-strand	20-26	7	1
β-strand	34-39	6	2
β-strand	45-49	5	2
β-strand	63-68	6	1
β-strand	71-76	6	1
α-helix	81-83	3
β-strand	86-91	6	2
α-helix	97	1
β-strand	98	1	3
β-strand	103-104	2	2
β-strand	116-120	5	4
α-helix	124-129	6
β-strand	131-141	11	4
β-strand	147-152	6	5
β-strand	155-157	3	5
β-strand	161-166	6	4
α-helix	167-169	3
β-strand	175-184	10	4
α-helix	185-189	5
β-strand	193-199	7	5
β-strand	207-212	6	5

Chain b: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	28-55	28

Chain B: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	32-40	9	3
β-strand	44-51	8	3
β-strand	58-60	3	3
β-strand	69-73	5	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-100	9	3
β-strand	111	1	3
β-strand	116-118	3	3
α-helix	126-128	3
β-strand	129-133	5	7
β-strand	148-154	7	7
β-strand	160-163	4	8
β-strand	173-174	2	7
α-helix	175-177	3
β-strand	178-180	3	7
β-strand	183-189	7	7
β-strand	203-208	6	8
β-strand	213-218	6	8

Chain C: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	9
β-strand	11-13	3	10
β-strand	19-25	7	9
β-strand	35-39	5	10
β-strand	45-50	6	10
β-strand	54-55	2	10
β-strand	63-68	6	9
β-strand	71-77	7	9
β-strand	86-90	5	10
α-helix	97	1
β-strand	98	1	11
β-strand	99	1	10
β-strand	103-106	4	10
β-strand	113	1	12
β-strand	116-120	5	13
α-helix	121-123	3
α-helix	124-129	6
β-strand	131-141	11	13
β-strand	142	1	12
β-strand	147-151	5	14
β-strand	162-164	3	13
α-helix	167-169	3
β-strand	175-184	10	13
α-helix	185-190	6
β-strand	193-199	7	14
β-strand	208-212	5	14

Chain d: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	26-29	4	19
β-strand	32-36	5	19
β-strand	42-46	5	20
β-strand	57-62	6	19
β-strand	68-72	5	20
β-strand	86-91	6	20
β-strand	96-98	3	21
α-helix	101-125	25

Chain D: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	15
β-strand	10-12	3	11
β-strand	17-25	9	15
α-helix	29-31	3
β-strand	32-40	9	11
β-strand	44-51	8	11
β-strand	58-60	3	11
β-strand	69-73	5	15
β-strand	78-84	7	15
α-helix	88-90	3
β-strand	92-100	9	11
β-strand	109-112	4	11
β-strand	113	1	15
β-strand	116-120	5	11
β-strand	126	1	16
β-strand	130-133	4	17
β-strand	146-154	9	17
β-strand	155	1	16
β-strand	160-163	4	18
β-strand	168	1	18
β-strand	172-174	3	17
α-helix	175-177	3
β-strand	178-180	3	17
β-strand	183-191	9	17
β-strand	203-208	6	18
β-strand	213-218	6	18

Chain e: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	34-36	3
β-strand	37-40	4	22
β-strand	44-48	5	22
β-strand	57-61	5	20
β-strand	65-66	2	20
β-strand	75-76	2	22
β-strand	81-85	5	22
α-helix	89-92	4
β-strand	94-100	7	20
β-strand	111-116	6	20
β-strand	122-124	3	21
α-helix	127-153	27

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UCHT1 Fab	A, C	protein	214	Homo sapiens
UCHT1 Fab chain 2	B, D	protein	222	Homo sapiens
T-cell surface glycoprotein CD3 zeta chain	a, b	protein	31	Homo sapiens	P20963 (AlphaFold model)
T-cell surface glycoprotein CD3 delta chain	d	protein	105	Homo sapiens	P04234 (AlphaFold model)
T-cell surface glycoprotein CD3 epsilon chain	e, f	protein	124	Homo sapiens	P07766 (AlphaFold model)
T-cell surface glycoprotein CD3 gamma chain	g	protein	115	Homo sapiens	P09693 (AlphaFold model)
T cell receptor delta constant	m	protein	36	Homo sapiens	B7Z8K6
T cell receptor gamma constant 1	n	protein	38	Homo sapiens	P0CF51

Sequence of entity 1 (A, C), FASTA

>9CI8_1 UCHT1 Fab (chains A, C)
MDIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKPDGTVKLLIYYTSRLHSGVP
SKFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFAGGTKLEIXXRADAAPTVSIF
PPASEQLTSGGASVVCFLNNFYPKSINSKWKIDGSERQNGVLNSWTDQDSKDSTYSMSST
LTLTKNEYERHNSYTCEATHKXXXSPIVKSFNRS

Sequence of entity 2 (B, D), FASTA

>9CI8_2 UCHT1 Fab chain 2 (chains B, D)
EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWMGLINPYKGVSTY
NQKFKDKATLTVDKSSSTAYMELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGQGTTLTV
FSAKTTPPSVYPLAPGSXXXXXXMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLK
SDLYTLSSSVTVXXXXXXXXXVTCNVAHPASSTTVDKKIVPR

Sequence of entity 3 (a, b), FASTA

>9CI8_3 T-cell surface glycoprotein CD3 zeta chain (chains a, b)
LDPKLCYLLDGILFIYGVILTALFLRVKFSR

Sequence of entity 4 (d), FASTA

>9CI8_4 T-cell surface glycoprotein CD3 delta chain (chains d)
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKD
KESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFA

Sequence of entity 5 (e, f), FASTA

>9CI8_5 T-cell surface glycoprotein CD3 epsilon chain (chains e, f)
QTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQ
SGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWS
KNRK

Sequence of entity 6 (g), FASTA

>9CI8_6 T-cell surface glycoprotein CD3 gamma chain (chains g)
SIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRG
MYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAG

Sequence of entity 7 (m), FASTA

>9CI8_7 T cell receptor delta constant (chains m)
HTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL

Sequence of entity 8 (n), FASTA

>9CI8_8 T cell receptor gamma constant 1 (chains n)
TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTA

Primary citation

Structure of a fully assembled gamma delta T cell antigen receptor. Gully, B.S., Ferreira Fernandes, J., Gunasinghe, S.D. et al. Nature (2024) 634:729-736. DOI 10.1038/s41586-024-07920-0 · PubMed

Other PDB entries of the same protein (UniProt P20963 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OQ1 1.9 Å, Tandem SH2 domains of ZAP-70 with 19-mer zeta1 peptide
3IK5 2.05 Å, SIVmac239 Nef in complex with TCR zeta ITAM 1 polypeptide (A63-R80)
8ES8 2.65 Å, CryoEM structure of PN45545 TCR-CD3 in complex with HLA-A2 MAGEA4 (230-239)
4XZ1 2.8 Å, ZAP-70-tSH2:Compound-B adduct
1YGR 2.9 Å, Crystal structure of the tandem phosphatase domain of RPTP CD45
7FJE 3.0 Å, Cryo-EM structure of a membrane protein(LL)
8ES7 3.04 Å, CryoEM structure of PN45545 TCR-CD3 complex
7PHR 3.08 Å, Structure of a fully assembled T-cell receptor engaging a tumor-associated peptide-MHC I
9JY1 3.08 Å, delta epsilon/delta epsilon Fab-TCR tetramer
7FJF 3.1 Å, Cryo-EM structure of a membrane protein(CS)
8TW6 3.1 Å, TCR in nanodisc ND-II
9IRU 3.14 Å, Cryo-em structure of TCR-4B1 complex

Browse structure collections

About this viewer

MolViewer shows 9CI8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.