1YGR: Tandem phosphatase domain of RPTP CD45

Crystal structure of the tandem phosphatase domain of RPTP CD45. Determined by X-ray diffraction at 2.9 Å resolution. Released 22 Feb 2005.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 9,537
Mol. weight: 144.78 kDa
Released: 22 Feb 2005

Explore 1YGR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1YGR contains 45 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	607	1
β-strand	608-609	2	1
α-helix	613-633	21
α-helix	650-655	6
β-strand	668-670	3	2
β-strand	682-688	7	2
β-strand	697-700	4	2
α-helix	701-704	4
α-helix	708-717	10
β-strand	722-725	4	2
β-strand	730-731	2	3
β-strand	734-735	2	3
β-strand	748-751	4	2
β-strand	754-763	10	2
β-strand	767-776	10	2
β-strand	784-791	8	2
α-helix	803-813	11
β-strand	824-827	4	2
α-helix	833-846	14
α-helix	848-851	4
β-strand	853-854	2	1
α-helix	856-864	9
α-helix	874-890	17
β-strand	896	1	4
α-helix	897-899	3
α-helix	900-907	8
α-helix	918-925	8
α-helix	937-939	3
α-helix	943-945	3
α-helix	953-955	3
β-strand	959	1	5
β-strand	995-999	5	5
β-strand	1006-1011	6	5
α-helix	1012-1014	3
α-helix	1018-1027	10
β-strand	1032-1035	4	5
β-strand	1040-1041	2	6
β-strand	1044-1045	2	6
β-strand	1057-1058	2	7
β-strand	1061-1062	2	7
β-strand	1065-1070	6	5
β-strand	1074-1081	8	5
β-strand	1082	1	7
β-strand	1090-1097	8	5
α-helix	1109-1120	12
β-strand	1140-1144	5	5
α-helix	1151-1166	16
β-strand	1169	1	4
α-helix	1172-1182	11
α-helix	1190-1202	13

Chain B: 23 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	607	1
β-strand	608-609	2	8
α-helix	613-631	19
α-helix	650-655	6
β-strand	668-670	3	9
β-strand	682-688	7	9
β-strand	697-700	4	9
α-helix	701-704	4
α-helix	708-717	10
β-strand	722-725	4	9
β-strand	730-731	2	10
β-strand	734-735	2	10
β-strand	748-751	4	9
β-strand	754-763	10	9
β-strand	767-776	10	9
β-strand	784-791	8	9
α-helix	803-813	11
α-helix	823	1
β-strand	824-827	4	9
α-helix	833-846	14
α-helix	848-851	4
β-strand	853-854	2	8
α-helix	856-864	9
α-helix	874-890	17
β-strand	896	1	11
α-helix	900-908	9
α-helix	918-925	8
α-helix	937-939	3
α-helix	943-945	3
α-helix	953-955	3
β-strand	959	1	12
α-helix	960-961	2
β-strand	995-999	5	12
β-strand	1006-1011	6	12
α-helix	1012-1014	3
α-helix	1018-1027	10
β-strand	1032-1035	4	12
β-strand	1040-1041	2	13
β-strand	1044-1045	2	13
β-strand	1057-1058	2	14
β-strand	1061-1062	2	14
β-strand	1065-1070	6	12
β-strand	1074-1081	8	12
β-strand	1082	1	14
β-strand	1090-1097	8	12
α-helix	1109-1121	13
β-strand	1140-1144	5	12
α-helix	1151-1166	16
β-strand	1169	1	11
α-helix	1172-1182	11
α-helix	1190-1202	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD45 Protein Tyrosine Phosphatase	A, B	protein	610	Homo sapiens	P08575 (AlphaFold model)
T-cell Receptor CD3 zeta ITAM-1	C, D	protein	6		P20963 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1YGR_1 CD45 Protein Tyrosine Phosphatase (chains A, B)
EKQLMNVEPIHADILLETYKRKIADEGRPFLAEFQSIPRVFSKFPIKEARKPFNQNKNRY
VDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQ
KATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKK
EKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHSSAGVGRTGTY
IGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETEVNLS
ELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSNVIPYDYN
RVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETI
GDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRV
FELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKST
PLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVKALRKARLGMVSTFEQYQFLYD
VIASTYPAQN

Sequence of entity 2 (C, D), FASTA

>1YGR_2 T-cell Receptor CD3 zeta ITAM-1 (chains C, D)
REEYDV

Primary citation

Structural basis for the function and regulation of the receptor protein tyrosine phosphatase CD45. Nam, H.J., Poy, F., Saito, H. et al. J Exp Med (2005) 201:441-452. DOI 10.1084/jem.20041890 · PubMed

Other PDB entries of the same protein (UniProt P08575 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FN7 2.3 Å, Crystal structure of human CD45 extracellular region, domains d1-d2
1YGU 2.9 Å, Crystal structure of the tandem phosphatase domains of RPTP CD45 with a pTyr peptide
5FMV 2.9 Å, Crystal structure of human CD45 extracellular region, domains d1-d4
5FN6 3.3 Å, Crystal structure of human CD45 extracellular region, domains d1-d3
8VSE 3.8 Å, Cryo-EM structure of human CD45 extracellular region in complex with adenoviral protein…

Browse structure collections

About this viewer

MolViewer shows 1YGR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.