9CRV: Gamma-aminobutyric acid receptor subunit beta-2

Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly. Determined by electron microscopy at 3.18 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.18 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 15,727
Mol. weight: 340.43 kDa
Ligands: ABU, PIO, POV, NAG
Released: 22 Jan 2025

Explore 9CRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CRV contains 54 α-helices and 111 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	35	1
β-strand	36-40	5	1
β-strand	43	1	2
β-strand	44-51	8	3
β-strand	56-61	6	3
β-strand	64-68	5	1
β-strand	81-83	3	1
α-helix	87-89	3
β-strand	96-98	3	4
β-strand	101-106	6	3
β-strand	114-118	5	1
β-strand	123-128	6	1
β-strand	130-135	6	3
β-strand	147-150	4	4
β-strand	153-156	4	4
β-strand	164-168	5	1
α-helix	171-174	4
β-strand	176	1	2
β-strand	186-200	15	4
β-strand	203-216	14	4
α-helix	217	1
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-229	3
α-helix	232-238	7
α-helix	247-267	21
α-helix	280-306	27
α-helix	461-485	25

Chain B: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
β-strand	39-54	16	5
β-strand	59-69	11	5
β-strand	71	1	6
α-helix	73-75	3
β-strand	84-86	3	7
α-helix	88-93	6
β-strand	99-101	3	8
β-strand	104	1	5
β-strand	108-109	2	5
β-strand	117	1	5
β-strand	119-121	3	7
β-strand	126	1	6
β-strand	127-128	2	7
β-strand	129-138	10	5
β-strand	150-159	10	8
β-strand	167-171	5	5
α-helix	175-177	3
β-strand	179-181	3	5
β-strand	191-204	14	8
β-strand	209-221	13	8
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-242	11
α-helix	243-246	4
α-helix	252-273	22
α-helix	285-309	25
α-helix	386-390	5
α-helix	391-416	26

Chain C: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	25-34	10
β-strand	51-66	16	9
β-strand	71-83	13	9
β-strand	95-98	4	9
α-helix	100-102	3
β-strand	111-113	3	10
β-strand	116-121	6	9
β-strand	129-134	6	9
β-strand	138-150	13	9
β-strand	162-165	4	10
β-strand	168-171	4	10
β-strand	179-183	5	9
β-strand	189-190	2	9
β-strand	201-215	15	10
β-strand	218-231	14	10
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-250	9
α-helix	251-254	4
α-helix	262-286	25
α-helix	295-321	27
α-helix	411-433	23

Chain D: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-41	6	11
β-strand	42-43	2	12
β-strand	44-51	8	13
β-strand	56-61	6	13
β-strand	64-68	5	11
β-strand	81-83	3	11
α-helix	85-90	6
β-strand	96-98	3	14
β-strand	101-106	6	13
β-strand	114-118	5	11
β-strand	123-128	6	11
β-strand	130-135	6	13
β-strand	147-156	10	14
β-strand	164-167	4	11
α-helix	171-174	4
β-strand	175-176	2	12
β-strand	188-196	9	14
β-strand	199-200	2	15
β-strand	203-204	2	15
β-strand	207-215	9	14
α-helix	221-224	4
α-helix	226-241	16
α-helix	247-266	20
α-helix	280-306	27
α-helix	462-485	24

Chain E: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	38-49	12	16
β-strand	53	1	16
β-strand	58-69	12	16
β-strand	70	1	17
β-strand	82-85	4	16
α-helix	87-90	4
β-strand	98-100	3	18
β-strand	103	1	16
β-strand	108	1	16
β-strand	116-121	6	16
β-strand	125	1	17
β-strand	128-137	10	16
α-helix	142-144	3
β-strand	151-158	8	18
β-strand	166-170	5	16
α-helix	175-177	3
β-strand	178-180	3	16
β-strand	190-204	15	18
β-strand	207-220	14	18
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-240	10
α-helix	241-245	5
α-helix	251-272	22
α-helix	286-309	24
α-helix	388-411	24

Chain K: 0 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	19
β-strand	10-12	3	20
β-strand	18	1	21
β-strand	21-25	5	19
β-strand	34-39	6	22
β-strand	45-52	8	22
β-strand	57-60	4	22
β-strand	68	1	21
β-strand	71-73	3	19
β-strand	78-80	3	19
β-strand	83	1	21
β-strand	93-98	6	22
β-strand	108	1	22
β-strand	112-113	2	22
β-strand	114-116	3	20

Chain L: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	23
β-strand	10-12	3	24
β-strand	19-20	2	25
β-strand	22-25	4	23
β-strand	35-38	4	26
β-strand	45-48	4	26
β-strand	54	1	26
α-helix	55	1
β-strand	62-65	4	25
β-strand	70-71	2	23
β-strand	72-75	4	25
β-strand	85-88	4	26
β-strand	89-90	2	27
β-strand	96-97	2	27
β-strand	101	1	26
β-strand	102-104	3	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A, D	protein	488	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B	protein	429	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	436	Homo sapiens	P18507 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-2	E	protein	423	Homo sapiens	P47869 (AlphaFold model)
IgG2b Fab_1F4 Heavy Chain	K	protein	454	Mus musculus
Kappa Fab_1F4 Light Chain	L	protein	213	Mus musculus

Sequence of entity 1 (A, D), FASTA

>9CRV_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, D)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP
TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA
GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI
VYWLYYVN

Sequence of entity 2 (B), FASTA

>9CRV_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ

Sequence of entity 3 (C), FASTA

>9CRV_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL

Sequence of entity 4 (E), FASTA

>9CRV_4 Gamma-aminobutyric acid receptor subunit alpha-2 (chains E)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTIS
KSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLG
VSP

Sequence of entity 5 (K), FASTA

>9CRV_5 IgG2b Fab_1F4 Heavy Chain (chains K)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Sequence of entity 6 (L), FASTA

>9CRV_6 Kappa Fab_1F4 Light Chain (chains L)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…

Browse structure collections

About this viewer

MolViewer shows 9CRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.