9CSX: Matrix metalloproteinase-10 proenzyme

matrix metalloproteinase-10 proenzyme. Determined by X-ray diffraction at 1.67 Å resolution. Released 13 Aug 2025.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,112
Mol. weight: 31.34 kDa
Ligands: CA, ZN
Released: 13 Aug 2025

Explore 9CSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CSX contains 7 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	27-41	15
α-helix	57-70	14
α-helix	80-87	8
β-strand	90	1	1
β-strand	112-117	6	2
α-helix	126-141	16
β-strand	147-150	4	2
β-strand	158-163	6	2
β-strand	179	1	1
β-strand	181-183	3	2
β-strand	194-197	4	2
β-strand	202-203	2	3
β-strand	209-210	2	3
α-helix	211-223	13
β-strand	238	1	1
α-helix	245-247	3
α-helix	252-262	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromelysin-2	A	protein	274	Homo sapiens	P09238 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9CSX_1 Stromelysin-2 (chains A)
YPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGK
LDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKAL
KVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFD
DDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNG
IQSLYGPPPASTEEPLVPTKSVPSGSEMPAKCDP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
ZN	Zinc ion	Zn	4

Water and common crystallization additives (ACY, IMD) are not listed.

Primary citation

Matrix metalloproteinase-10 (MMP-10) proenzyme. Isiorho, E.A. To be published.

Other PDB entries of the same protein (UniProt P09238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V96 1.9 Å, Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor…
1Q3A 2.1 Å, Crystal structure of the catalytic domain of human matrix metalloproteinase 10
4ILW 2.1 Å, Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor…

Browse structure collections

About this viewer

MolViewer shows 9CSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.