Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor of metalloproteinases-1 (TIMP-1). Determined by X-ray diffraction at 1.9 Å resolution. Released 28 Mar 2012.
Explore 3V96 in 3D Show helices and sheets RCSB PDB PDBe
3V96 contains 13 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| α-helix | 4-7 | 4 | |
| α-helix | 8-14 | 7 | |
| β-strand | 17-23 | 7 | 2 |
| β-strand | 35-39 | 5 | 3 |
| β-strand | 40-47 | 8 | 2 |
| β-strand | 60-64 | 5 | 3 |
| α-helix | 67-69 | 3 | |
| β-strand | 82-87 | 6 | 2 |
| β-strand | 88-90 | 3 | 3 |
| β-strand | 93-95 | 3 | 3 |
| β-strand | 102-104 | 3 | 2 |
| α-helix | 105-107 | 3 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-119 | 5 | |
| α-helix | 120-122 | 3 | |
| β-strand | 128-131 | 4 | 4 |
| β-strand | 144-147 | 4 | 4 |
| α-helix | 149-153 | 5 | |
| α-helix | 159-163 | 5 | |
| β-strand | 165-170 | 6 | 5 |
| β-strand | 173-177 | 5 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 112-117 | 6 | 1 |
| α-helix | 126-141 | 16 | |
| β-strand | 147-150 | 4 | 1 |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 179-183 | 5 | 1 |
| β-strand | 194-197 | 4 | 1 |
| β-strand | 202-203 | 2 | 6 |
| β-strand | 209-210 | 2 | 6 |
| α-helix | 211-223 | 13 | |
| β-strand | 238 | 1 | 1 |
| α-helix | 242-247 | 6 | |
| α-helix | 252-262 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metalloproteinase inhibitor 1 | A | protein | 184 | Homo sapiens | P01033 (AlphaFold model) |
| Stromelysin-2 | B | protein | 165 | Homo sapiens | P09238 (AlphaFold model) |
>3V96_1 Metalloproteinase inhibitor 1 (chains A) CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQTTLYQRYEIKMTKMYKGFQALGDAADIRF VYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTY TVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLR SQIA
>3V96_2 Stromelysin-2 (chains B) FSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADI MISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHE LGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYG
Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure. Batra, J., Robinson, J., Soares, A.S. et al. J Biol Chem (2012) 287:15935-15946. DOI 10.1074/jbc.M112.341156 · PubMed
Other PDB entries of the same protein (UniProt P01033 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3V96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.