9CT0: Gamma-aminobutyric acid receptor subunit beta-2

Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly. Determined by electron microscopy at 3.19 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.19 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 14,736
Mol. weight: 340.82 kDa
Ligands: ABU, PIO, POV, NAG
Released: 22 Jan 2025

Explore 9CT0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CT0 contains 47 α-helices and 100 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
β-strand	36-47	12	1
β-strand	51	1	1
β-strand	56-68	13	1
β-strand	81-83	3	1
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	114-118	5	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
β-strand	175-176	2	1
β-strand	188-199	12	2
β-strand	204-215	12	2
α-helix	220-221	2
α-helix	222-226	5
α-helix	227-235	9
α-helix	236-240	5
α-helix	247-269	23
α-helix	280-303	24
α-helix	304-308	5
α-helix	463-485	23

Chain B: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39-54	16	3
β-strand	59-69	11	3
β-strand	71	1	4
β-strand	83-86	4	3
β-strand	99-101	3	5
β-strand	104-109	6	3
β-strand	113	1	2
β-strand	117-122	6	3
β-strand	126	1	4
β-strand	129-138	10	3
β-strand	150-154	5	5
β-strand	157-159	3	5
β-strand	167-171	5	3
α-helix	175-177	3
β-strand	179-181	3	3
β-strand	186	1	3
β-strand	191-204	14	5
β-strand	209-221	13	5
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-242	11
α-helix	243-246	4
α-helix	252-273	22
α-helix	285-309	25
α-helix	391-396	6
α-helix	399-415	17

Chain C: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	35	1
β-strand	36-47	12	6
β-strand	51	1	6
β-strand	56-68	13	6
α-helix	70-72	3
β-strand	81-83	3	6
α-helix	85-90	6
β-strand	96-98	3	7
β-strand	101-106	6	6
β-strand	114-118	5	6
β-strand	123-135	13	6
β-strand	147-156	10	7
β-strand	164-168	5	6
α-helix	171-173	3
β-strand	175-176	2	6
β-strand	186-200	15	7
β-strand	203-216	14	7
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-238	12
α-helix	239-241	3
α-helix	247-267	21
α-helix	280-305	26
α-helix	461-486	26

Chain D: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
β-strand	38-53	16	8
β-strand	58-70	13	8
β-strand	82-85	4	8
α-helix	87-89	3
β-strand	99-100	2	9
β-strand	107-108	2	8
β-strand	116-121	6	8
β-strand	125-134	10	8
β-strand	137	1	8
β-strand	153-157	5	9
β-strand	166-170	5	8
β-strand	178-180	3	8
β-strand	185	1	8
β-strand	190-199	10	9
β-strand	202-204	3	10
β-strand	207-209	3	10
β-strand	211-220	10	9
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-240	10
α-helix	243-245	3
α-helix	251-273	23
α-helix	282-283	2
α-helix	286-308	23
α-helix	388-391	4
α-helix	396-411	16

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	51-62	12	11
β-strand	72-83	12	11
β-strand	95-98	4	11
α-helix	103-105	3
β-strand	111-113	3	12
β-strand	116-121	6	11
β-strand	129-134	6	11
β-strand	138-149	12	11
β-strand	162-171	10	12
β-strand	179-188	10	11
β-strand	201-215	15	12
β-strand	218-231	14	12

Chain I: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	13
β-strand	7	1	14
β-strand	10-12	3	15
β-strand	19-20	2	16
β-strand	22	1	14
β-strand	23-24	2	17
β-strand	25	1	13
β-strand	33-38	6	18
β-strand	45-49	5	18
β-strand	53-54	2	18
α-helix	55	1
β-strand	62-65	4	16
β-strand	70-71	2	17
β-strand	72-75	4	16
α-helix	80-82	3
β-strand	85-90	6	18
β-strand	96-97	2	18
β-strand	101	1	18
β-strand	102-104	3	15

Chain J: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	19
β-strand	10-11	2	20
β-strand	17-25	9	19
β-strand	34-39	6	21
β-strand	45-51	7	21
β-strand	58-60	3	21
β-strand	65	1	19
β-strand	68-73	6	19
β-strand	78-84	7	19
α-helix	88-90	3
β-strand	93-98	6	21
β-strand	108	1	21
β-strand	112-113	2	21
β-strand	114-115	2	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A, C	protein	488	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B	protein	429	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-2	D	protein	423	Homo sapiens	P47869 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	436	Homo sapiens	P18507 (AlphaFold model)
Kappa Fab_1F4 Light Chain	I	protein	213	Mus musculus
IgG2b Fab_1F4 Heavy Chain	J	protein	454	Mus musculus

Sequence of entity 1 (A, C), FASTA

>9CT0_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A, C)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP
TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA
GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI
VYWLYYVN

Sequence of entity 2 (B), FASTA

>9CT0_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ

Sequence of entity 3 (D), FASTA

>9CT0_3 Gamma-aminobutyric acid receptor subunit alpha-2 (chains D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTIS
KSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLG
VSP

Sequence of entity 4 (E), FASTA

>9CT0_4 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL

Sequence of entity 5 (I), FASTA

>9CT0_5 Kappa Fab_1F4 Light Chain (chains I)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 6 (J), FASTA

>9CT0_6 IgG2b Fab_1F4 Heavy Chain (chains J)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…

Browse structure collections

About this viewer

MolViewer shows 9CT0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.