9CTJ: Gamma-aminobutyric acid receptor subunit beta-2
Native human GABAA receptor of beta2-alpha1-beta3-alpha2-gamma2 assembly. Determined by electron microscopy at 3.74 Å resolution. Released 22 Jan 2025.
- Method
- Electron microscopy
- Resolution
- 3.74 Å
- Organisms
- Homo sapiens, Mus musculus
- Chains
- 7
- Atoms
- 14,465
- Mol. weight
- 332.67 kDa
- Ligands
- NAG
- Released
- 22 Jan 2025
Explore 9CTJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9CTJ contains 50 α-helices and 100 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-19 | 11 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 1 |
| β-strand | 56-68 | 13 | 1 |
| β-strand | 81-83 | 3 | 1 |
| α-helix | 85-87 | 3 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 101-106 | 6 | 1 |
| β-strand | 114-118 | 5 | 1 |
| β-strand | 123-135 | 13 | 1 |
| α-helix | 140-142 | 3 | |
| β-strand | 149-150 | 2 | 3 |
| β-strand | 153-155 | 3 | 2 |
| β-strand | 164-167 | 4 | 1 |
| α-helix | 171-174 | 4 | |
| β-strand | 175-176 | 2 | 1 |
| β-strand | 188-193 | 6 | 3 |
| β-strand | 196-200 | 5 | 2 |
| β-strand | 203-209 | 7 | 2 |
| β-strand | 210-214 | 5 | 3 |
| α-helix | 220-221 | 2 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 247-269 | 23 | |
| α-helix | 280-303 | 24 | |
| α-helix | 304-308 | 5 | |
| α-helix | 463-486 | 24 | |
Chain B: 11 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-22 | 10 | |
| β-strand | 39-54 | 16 | 4 |
| β-strand | 59-69 | 11 | 4 |
| β-strand | 71 | 1 | 5 |
| β-strand | 83-86 | 4 | 6 |
| β-strand | 101 | 1 | 7 |
| β-strand | 104 | 1 | 4 |
| β-strand | 108-109 | 2 | 4 |
| β-strand | 117 | 1 | 4 |
| β-strand | 119-122 | 4 | 6 |
| β-strand | 126 | 1 | 5 |
| β-strand | 129-138 | 10 | 4 |
| β-strand | 152-157 | 6 | 7 |
| β-strand | 167-171 | 5 | 4 |
| α-helix | 175-177 | 3 | |
| β-strand | 179-181 | 3 | 4 |
| β-strand | 186 | 1 | 4 |
| β-strand | 191 | 1 | 8 |
| β-strand | 195-204 | 10 | 7 |
| β-strand | 209-218 | 10 | 7 |
| β-strand | 221 | 1 | 8 |
| α-helix | 225-226 | 2 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-242 | 11 | |
| α-helix | 243-246 | 4 | |
| α-helix | 252-272 | 21 | |
| α-helix | 285-309 | 25 | |
| α-helix | 387-390 | 4 | |
| α-helix | 391-396 | 6 | |
| α-helix | 399-417 | 19 | |
Chain C: 13 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-19 | 12 | |
| α-helix | 35 | 1 | |
| β-strand | 36-47 | 12 | 9 |
| β-strand | 56-68 | 13 | 9 |
| α-helix | 70-72 | 3 | |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 10 |
| β-strand | 101-106 | 6 | 9 |
| β-strand | 114-118 | 5 | 9 |
| β-strand | 123-135 | 13 | 9 |
| β-strand | 147-156 | 10 | 10 |
| β-strand | 164-168 | 5 | 9 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-176 | 2 | 9 |
| β-strand | 186-200 | 15 | 10 |
| β-strand | 203-216 | 14 | 10 |
| α-helix | 217 | 1 | |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-268 | 22 | |
| α-helix | 280-307 | 28 | |
| α-helix | 423-445 | 23 | |
Chain D: 9 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-21 | 11 | |
| β-strand | 38-53 | 16 | 11 |
| β-strand | 58-70 | 13 | 11 |
| β-strand | 83-85 | 3 | 11 |
| β-strand | 99-100 | 2 | 12 |
| β-strand | 103 | 1 | 11 |
| β-strand | 108 | 1 | 11 |
| β-strand | 110 | 1 | 13 |
| β-strand | 114 | 1 | 13 |
| β-strand | 116 | 1 | 11 |
| β-strand | 118-120 | 3 | 11 |
| β-strand | 125-137 | 13 | 11 |
| β-strand | 151-152 | 2 | 12 |
| β-strand | 156-157 | 2 | 12 |
| β-strand | 166-170 | 5 | 11 |
| β-strand | 178-180 | 3 | 11 |
| α-helix | 181 | 1 | |
| β-strand | 185 | 1 | 11 |
| β-strand | 190-204 | 15 | 12 |
| β-strand | 207-220 | 14 | 12 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-240 | 10 | |
| α-helix | 241-245 | 5 | |
| α-helix | 251-272 | 22 | |
| α-helix | 286-308 | 23 | |
| α-helix | 388-411 | 24 | |
Chain E: 2 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-34 | 9 | |
| β-strand | 51-66 | 16 | 14 |
| β-strand | 71-83 | 13 | 14 |
| β-strand | 95-98 | 4 | 14 |
| α-helix | 100-105 | 6 | |
| β-strand | 111-113 | 3 | 15 |
| β-strand | 118-121 | 4 | 14 |
| β-strand | 129-134 | 6 | 14 |
| β-strand | 138-148 | 11 | 14 |
| β-strand | 162-171 | 10 | 15 |
| β-strand | 179-190 | 12 | 14 |
| β-strand | 201-215 | 15 | 15 |
| β-strand | 218-231 | 14 | 15 |
Chain I: 2 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4 | 1 | 16 |
| β-strand | 7 | 1 | 17 |
| β-strand | 10-12 | 3 | 18 |
| β-strand | 18-24 | 7 | 17 |
| β-strand | 25 | 1 | 16 |
| β-strand | 33-38 | 6 | 19 |
| β-strand | 45-49 | 5 | 19 |
| β-strand | 53-54 | 2 | 19 |
| α-helix | 55 | 1 | |
| β-strand | 62-65 | 4 | 17 |
| β-strand | 70-76 | 7 | 17 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-90 | 6 | 19 |
| β-strand | 96-97 | 2 | 19 |
| β-strand | 101 | 1 | 19 |
| β-strand | 102-104 | 3 | 18 |
Chain J: 1 helix, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 20 |
| β-strand | 10-11 | 2 | 21 |
| β-strand | 17-25 | 9 | 20 |
| β-strand | 34-39 | 6 | 22 |
| β-strand | 45-52 | 8 | 22 |
| β-strand | 57-60 | 4 | 22 |
| β-strand | 68-73 | 6 | 20 |
| β-strand | 78-84 | 7 | 20 |
| α-helix | 88-90 | 3 | |
| β-strand | 93-98 | 6 | 22 |
| β-strand | 108 | 1 | 22 |
| β-strand | 112-113 | 2 | 22 |
| β-strand | 114-115 | 2 | 21 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit beta-2 | A | protein | 488 | Homo sapiens | P47870 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit alpha-1 | B | protein | 429 | Homo sapiens | P14867 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit beta-3 | C | protein | 448 | Homo sapiens | P28472 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit alpha-2 | D | protein | 423 | Homo sapiens | P47869 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit gamma-2 | E | protein | 436 | Homo sapiens | P18507 |
| Kappa Fab_1F4 Light Chain | I | protein | 213 | Mus musculus | |
| IgG2b Fab_1F4 Heavy Chain | J | protein | 454 | Mus musculus | |
Sequence of entity 1 (A), FASTA
>9CTJ_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP
TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA
GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI
VYWLYYVN
Sequence of entity 2 (B), FASTA
>9CTJ_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ
Sequence of entity 3 (C), FASTA
>9CTJ_3 Gamma-aminobutyric acid receptor subunit beta-3 (chains C)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGI
GDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDV
NAIDRWSRIVFPFTFSLFNLVYWLYYVN
Sequence of entity 4 (D), FASTA
>9CTJ_4 Gamma-aminobutyric acid receptor subunit alpha-2 (chains D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTIS
KSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLG
VSP
Sequence of entity 5 (E), FASTA
>9CTJ_5 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL
Sequence of entity 6 (I), FASTA
>9CTJ_6 Kappa Fab_1F4 Light Chain (chains I)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Sequence of entity 7 (J), FASTA
>9CTJ_7 IgG2b Fab_1F4 Heavy Chain (chains J)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Primary citation
Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed
Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
- 8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
- 8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
- 8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
- 8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
- 6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
- 8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
- 8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
- 9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
- 6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
- 9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
- 8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
Browse structure collections
About this viewer
MolViewer shows 9CTJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.