9CTV: Gamma-aminobutyric acid receptor subunit beta-2

Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly. Determined by electron microscopy at 3.36 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.36 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 14,567
Mol. weight: 334.7 kDa
Ligands: NAG, POV, PIO
Released: 22 Jan 2025

Explore 9CTV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CTV contains 48 α-helices and 103 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-40	5	1
β-strand	42-47	6	1
β-strand	51	1	1
β-strand	56-68	13	1
β-strand	81-82	2	1
β-strand	96-98	3	2
β-strand	101	1	1
β-strand	105-106	2	1
β-strand	108	1	3
β-strand	112	1	3
β-strand	114-118	5	1
β-strand	123-135	13	1
β-strand	147-156	10	2
β-strand	164-168	5	1
α-helix	171-173	3
β-strand	175-176	2	1
β-strand	188-200	13	2
β-strand	203-215	13	2
α-helix	218-225	8
α-helix	232-238	7
α-helix	247-267	21
α-helix	280-303	24
α-helix	304-308	5
α-helix	462-485	24

Chain B: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	13-23	11
β-strand	39-54	16	4
β-strand	59-71	13	4
β-strand	84-86	3	4
α-helix	91-93	3
β-strand	99-101	3	5
β-strand	104	1	4
β-strand	108-109	2	4
β-strand	117-121	5	4
β-strand	126-138	13	4
α-helix	143-145	3
β-strand	150-153	4	5
β-strand	156-159	4	5
β-strand	167-171	5	4
α-helix	175-177	3
β-strand	179-181	3	4
β-strand	191-204	14	5
β-strand	209-221	13	5
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-241	10
α-helix	242-246	5
α-helix	252-272	21
α-helix	283-284	2
α-helix	285-309	25
α-helix	388-390	3
α-helix	391-415	25

Chain C: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	26-34	9
β-strand	51-66	16	6
β-strand	71-83	13	6
β-strand	95-98	4	6
α-helix	100-102	3
β-strand	111-113	3	7
β-strand	116-121	6	6
β-strand	129-134	6	6
β-strand	138-150	13	6
β-strand	162-165	4	7
β-strand	168-171	4	7
β-strand	179-182	4	6
β-strand	188-190	3	6
β-strand	202-215	14	7
β-strand	218-230	13	7

Chain D: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	28	1
α-helix	35	1
β-strand	36-40	5	8
β-strand	41-51	11	9
β-strand	56-68	13	9
β-strand	81-83	3	9
β-strand	97-98	2	10
β-strand	101	1	9
β-strand	105-106	2	9
β-strand	114-118	5	9
β-strand	123-135	13	9
α-helix	140-142	3
β-strand	147-155	9	10
β-strand	164-168	5	8
β-strand	176	1	9
β-strand	186-199	14	10
β-strand	204-216	13	10
α-helix	217	1
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	238-241	4
α-helix	247-270	24
α-helix	280-305	26
α-helix	423-444	22

Chain E: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
β-strand	38-46	9	11
β-strand	48-53	6	11
β-strand	58-69	12	11
β-strand	70	1	12
β-strand	83-85	3	13
α-helix	88-92	5
β-strand	98-100	3	14
β-strand	103	1	11
β-strand	107-108	2	11
β-strand	112	1	10
β-strand	118-120	3	13
β-strand	125	1	12
β-strand	128-137	10	11
α-helix	142-144	3
β-strand	151-158	8	14
β-strand	166-170	5	11
α-helix	174-177	4
β-strand	178-180	3	11
β-strand	185	1	11
β-strand	190-204	15	14
β-strand	207-220	14	14
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-241	11
α-helix	242-245	4
α-helix	251-272	22
α-helix	284-308	25
α-helix	388-411	24

Chain K: 0 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	15
β-strand	10-12	3	16
β-strand	18	1	17
β-strand	21-25	5	15
β-strand	34-39	6	18
β-strand	45-52	8	18
β-strand	57-60	4	18
β-strand	68	1	17
β-strand	71-73	3	15
β-strand	78-80	3	15
β-strand	83	1	17
β-strand	93-98	6	18
β-strand	108	1	18
β-strand	112-113	2	18
β-strand	114-116	3	16

Chain L: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-12	3	20
β-strand	19-25	7	19
β-strand	33-38	6	21
β-strand	45-48	4	21
β-strand	54	1	21
α-helix	55	1
β-strand	62-65	4	19
β-strand	70-75	6	19
β-strand	85-90	6	21
β-strand	97	1	21
β-strand	101	1	21
β-strand	102-104	3	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A	protein	487	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B	protein	429	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	436	Homo sapiens	P18507 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-1	D	protein	449	Homo sapiens	P18505 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-2	E	protein	423	Homo sapiens	P47869
IgG2b Fab_1F4 Heavy Chain	K	protein	454	Mus musculus
Kappa Fab_1F4 Light Chain	L	protein	213	Mus musculus

Sequence of entity 1 (A), FASTA

>9CTV_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A)
SVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTM
YFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPD
GTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKI
ELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFW
INYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYAL
VNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPT
RRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAG
LPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIV
YWLYYVN

Sequence of entity 2 (B), FASTA

>9CTV_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ

Sequence of entity 3 (C), FASTA

>9CTV_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL

Sequence of entity 4 (D), FASTA

>9CTV_4 Gamma-aminobutyric acid receptor subunit beta-1 (chains D)
HSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLT
MYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNK
IELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSF
WINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYA
FVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLT
SVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTD
VNSIDKWSRMFFPITFSLFNVVYWLYYVH

Sequence of entity 5 (E), FASTA

>9CTV_5 Gamma-aminobutyric acid receptor subunit alpha-2 (chains E)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTIS
KSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLG
VSP

Sequence of entity 6 (K), FASTA

>9CTV_6 IgG2b Fab_1F4 Heavy Chain (chains K)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Sequence of entity 7 (L), FASTA

>9CTV_7 Kappa Fab_1F4 Light Chain (chains L)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	1
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…

Browse structure collections

About this viewer

MolViewer shows 9CTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.