9CXB: Gamma-aminobutyric acid receptor subunit beta-2

Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly. Determined by electron microscopy at 3.33 Å resolution. Released 22 Jan 2025.

Method: Electron microscopy
Resolution: 3.33 Å
Organisms: Homo sapiens, Mus musculus
Chains: 7
Atoms: 14,479
Mol. weight: 333.66 kDa
Ligands: NAG, POV, ABU
Released: 22 Jan 2025

Explore 9CXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CXB contains 54 α-helices and 110 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-20	13
α-helix	35	1
β-strand	36-51	16	1
β-strand	56-66	11	1
α-helix	80	1
β-strand	81-83	3	1
β-strand	96-98	3	2
β-strand	101-106	6	1
β-strand	114-118	5	1
β-strand	125-135	11	1
β-strand	147-150	4	2
β-strand	153-156	4	2
β-strand	164-168	5	1
α-helix	171-173	3
β-strand	175-176	2	1
β-strand	186-199	14	2
β-strand	204-216	13	2
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-240	4
α-helix	247-269	23
α-helix	280-303	24
α-helix	304-308	5
α-helix	462-485	24

Chain B: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39-54	16	3
β-strand	59-70	12	3
β-strand	71	1	4
β-strand	83-86	4	3
α-helix	89-92	4
β-strand	99-101	3	5
β-strand	104	1	3
β-strand	108-109	2	3
β-strand	113	1	2
β-strand	117-122	6	3
β-strand	126	1	4
β-strand	129-138	10	3
α-helix	143-145	3
β-strand	150-154	5	5
β-strand	157-159	3	5
β-strand	167-171	5	3
α-helix	175-177	3
β-strand	179-181	3	3
β-strand	186	1	3
β-strand	191-204	14	5
β-strand	209-221	13	5
α-helix	226-229	4
α-helix	231-242	12
α-helix	243-246	4
α-helix	252-273	22
α-helix	285-309	25
α-helix	391-416	26

Chain C: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	35	1
β-strand	36-51	16	6
β-strand	56-68	13	6
β-strand	81-83	3	6
α-helix	85-90	6
β-strand	97-98	2	7
β-strand	101-106	6	6
β-strand	114-118	5	6
β-strand	123-128	6	6
β-strand	130-135	6	6
α-helix	137-139	3
β-strand	147-155	9	7
β-strand	164-168	5	6
α-helix	171-174	4
β-strand	175-176	2	6
β-strand	186-199	14	7
β-strand	204-216	13	7
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-235	9
α-helix	238-241	4
α-helix	247-266	20
α-helix	280-305	26
α-helix	424-427	4
α-helix	428-430	3
α-helix	432-444	13

Chain D: 11 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	10-21	12
β-strand	38-46	9	8
β-strand	48-53	6	9
β-strand	58-63	6	9
β-strand	65-68	4	8
β-strand	70	1	10
β-strand	82-85	4	11
α-helix	87-92	6
β-strand	99-100	2	12
β-strand	107-108	2	9
β-strand	110	1	13
β-strand	114	1	13
β-strand	118-121	4	11
β-strand	125	1	10
β-strand	128-129	2	8
β-strand	132-134	3	9
β-strand	137	1	9
α-helix	142-144	3
β-strand	151-157	7	12
β-strand	166-170	5	8
β-strand	178-180	3	8
β-strand	185	1	9
β-strand	190	1	14
β-strand	194-198	5	12
β-strand	201-203	3	15
β-strand	208-210	3	15
β-strand	212-217	6	12
β-strand	220	1	14
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-240	10
α-helix	241-245	5
α-helix	251-271	21
α-helix	273-275	3
α-helix	286-308	23
α-helix	388-411	24

Chain E: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	27-34	8
α-helix	50	1
β-strand	51-66	16	16
β-strand	71-83	13	16
β-strand	95-98	4	16
α-helix	100-105	6
β-strand	111-113	3	17
β-strand	116-121	6	16
β-strand	129-134	6	16
β-strand	138-150	13	16
β-strand	162-171	10	17
β-strand	179-182	4	16
β-strand	189	1	16
β-strand	201-214	14	17
β-strand	219-231	13	17

Chain I: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	18
β-strand	7	1	19
β-strand	10-12	3	20
β-strand	19-20	2	21
β-strand	22	1	19
β-strand	23-24	2	22
β-strand	25	1	18
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-65	4	21
β-strand	70-71	2	22
β-strand	72-75	4	21
α-helix	80-82	3
β-strand	85-90	6	20
β-strand	96-97	2	20
β-strand	101-104	4	20

Chain J: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	23
β-strand	10-12	3	24
β-strand	17-25	9	23
β-strand	34-39	6	25
β-strand	45-51	7	25
β-strand	58-60	3	25
α-helix	62-64	3
β-strand	65	1	23
β-strand	68-73	6	23
β-strand	78-84	7	23
α-helix	88-90	3
β-strand	93-98	6	25
β-strand	108	1	25
β-strand	112-113	2	25
β-strand	114-116	3	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit beta-2	A	protein	488	Homo sapiens	P47870 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-1	B	protein	429	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-1	C	protein	449	Homo sapiens	P18505 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit alpha-2	D	protein	423	Homo sapiens	P47869 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	E	protein	436	Homo sapiens	P18507
Kappa Fab_1F4 Light Chain	I	protein	213	Homo sapiens
IgG2b Fab_1F4 Heavy Chain	J	protein	454	Mus musculus

Sequence of entity 1 (A), FASTA

>9CXB_1 Gamma-aminobutyric acid receptor subunit beta-2 (chains A)
QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLT
MYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTK
IELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYA
LVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSP
TRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKA
GLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNI
VYWLYYVN

Sequence of entity 2 (B), FASTA

>9CXB_2 Gamma-aminobutyric acid receptor subunit alpha-1 (chains B)
QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEY
TIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLR
ITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVV
VAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSA
LIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLA
TIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREP
QLKAPTPHQ

Sequence of entity 3 (C), FASTA

>9CXB_3 Gamma-aminobutyric acid receptor subunit beta-1 (chains C)
HSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLT
MYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNK
IELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSF
WINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYA
FVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLT
SVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTD
VNSIDKWSRMFFPITFSLFNVVYWLYYVH

Sequence of entity 4 (D), FASTA

>9CXB_4 Gamma-aminobutyric acid receptor subunit alpha-2 (chains D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTIS
KSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLG
VSP

Sequence of entity 5 (E), FASTA

>9CXB_5 Gamma-aminobutyric acid receptor subunit gamma-2 (chains E)
QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQM
NNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPT
AFCLFNLVYWVSYLYL

Sequence of entity 6 (I), FASTA

>9CXB_6 Kappa Fab_1F4 Light Chain (chains I)
NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 7 (J), FASTA

>9CXB_7 IgG2b Fab_1F4 Heavy Chain (chains J)
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKY
DPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHR
EDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPP
PAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMK
TSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	1
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2

Primary citation

Resolving native GABA A receptor structures from the human brain. Zhou, J., Noviello, C.M., Teng, J. et al. Nature (2025) 638:562-568. DOI 10.1038/s41586-024-08454-1 · PubMed

Other PDB entries of the same protein (UniProt P47870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
8SID 2.71 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…
8VQY 2.82 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone
6X40 2.86 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin
8DD2 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem
8DD3 2.9 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM
9CRS 2.9 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly
6X3X 2.92 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam
9DRX 2.95 Å, Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA…
8SI9 2.98 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus…

Browse structure collections

About this viewer

MolViewer shows 9CXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.