9D5G: ILK/alpha-parvin core complex

Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib. Determined by X-ray diffraction at 1.55 Å resolution. Released 29 Oct 2025.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,546
Mol. weight: 46.5 kDa
Ligands: B3P, A1A2V
Released: 29 Oct 2025

Explore 9D5G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9D5G contains 28 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAAA: 19 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	190-192	3
β-strand	194-202	9	1
β-strand	205-212	8	1
β-strand	215-222	8	1
α-helix	229-238	10
α-helix	239-242	4
β-strand	250-251	2	2
β-strand	253-257	5	1
β-strand	266-270	5	1
β-strand	276	1	2
α-helix	277-282	6
α-helix	291-308	18
α-helix	314-315	2
α-helix	322-324	3
β-strand	325-327	3	2
β-strand	333-336	4	2
α-helix	337-339	3
α-helix	340-342	3
β-strand	350	1	3
α-helix	353-355	3
α-helix	358-361	4
α-helix	365-367	3
α-helix	370-387	18
α-helix	397-407	11
α-helix	411-414	4
α-helix	419-428	10
α-helix	433-435	3
α-helix	437-438	2
α-helix	439-448	10

Chain BBBB: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	250-254	5
α-helix	258-276	19
α-helix	277-279	3
α-helix	294-304	11
β-strand	307	1	3
α-helix	310-312	3
α-helix	320-336	17
α-helix	339-342	4
α-helix	346-350	5
α-helix	354-368	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin-linked protein kinase	AAAA	protein	271	Homo sapiens	Q13418 (AlphaFold model)
Alpha-parvin	BBBB	protein	129	Homo sapiens	Q9NVD7 (AlphaFold model)

Sequence of entity 1 (AAAA), FASTA

>9D5G_1 Integrin-linked protein kinase (chains AAAA)
MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR
LRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDM
ARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQSPGRMYAPAWVAPEAL
QKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHV
SKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Sequence of entity 2 (BBBB), FASTA

>9D5G_2 Alpha-parvin (chains BBBB)
GSHMDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLL
EGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYN
LFTKYRNVE

Ligands and cofactors

ID	Name	Formula	Copies
B3P	2-[3-(2-hydroxy-1,1-dihydroxymethyl-ethylamino)-propylamino]-2-hydroxymethyl-pr…	C11 H26 N2 O6	1
A1A2V	4-methyl Erlotinib	C23 H25 N3 O4	1

Primary citation

Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib. Fukuda, K., Qin, J. To be published.

Other PDB entries of the same protein (UniProt Q13418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HI8 1.2 Å, Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1…
4HI9 1.2 Å, 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
9TP9 1.45 Å, Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
3F6Q 1.6 Å, Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)
3REP 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (MnATP)

Browse structure collections

About this viewer

MolViewer shows 9D5G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.