9DDS: Human AAGAB G domain with E144K mutation

Crystal structure of human AAGAB G domain with E144K mutation. Determined by X-ray diffraction at 1.78 Å resolution. Released 16 Jul 2025.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,924
Mol. weight: 39.35 kDa
Released: 16 Jul 2025

Explore 9DDS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DDS contains 16 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-12	6	1
α-helix	19-28	10
β-strand	43-50	8	1
β-strand	54-62	9	1
α-helix	66-68	3
α-helix	71-76	6
β-strand	77-83	7	1
α-helix	93-98	6
α-helix	99-105	7
β-strand	109-114	6	1
α-helix	124-134	11
β-strand	137-140	4	1
α-helix	158-167	10
β-strand	175-176	2	1

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-12	6	2
α-helix	19-27	9
β-strand	35-36	2	2
β-strand	43-50	8	2
β-strand	54-62	9	2
α-helix	66-68	3
α-helix	71-76	6
β-strand	77-83	7	2
α-helix	93-98	6
α-helix	99-105	7
β-strand	109-114	6	2
α-helix	124-134	11
β-strand	137-140	4	2
α-helix	158-167	10
β-strand	175-176	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha- and gamma-adaptin-binding protein p34	A, B	protein	177	Homo sapiens	Q6PD74 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9DDS_1 Alpha- and gamma-adaptin-binding protein p34 (chains A, B)
MAAGVPCALVTSCSSVFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAKAWLPEVMILVCDRVSED
GINRQKAQEWCIKHGFELVELSPKELPEEDDDFPESTGVKRIVQALNANVWSNVVMK

Primary citation

Structural basis of pseudoGTPase-mediated protein-protein interactions. Wang, B., Yang, R., Wan, C. et al. Structure (2025) 33:1676-1687.e5. DOI 10.1016/j.str.2025.07.009 · PubMed

Other PDB entries of the same protein (UniProt Q6PD74 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DDT 1.68 Å, AAGAB pseudoGTPase domain in complex with AP-1 clathrin adaptor complex sigma 3 subunit
7TWD 2.11 Å, Structure of AAGAB C-terminal dimerization domain

Browse structure collections

About this viewer

MolViewer shows 9DDS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.