9DDT: AAGAB pseudoGTPase domain

AAGAB pseudoGTPase domain in complex with AP-1 clathrin adaptor complex sigma 3 subunit. Determined by X-ray diffraction at 1.68 Å resolution. Released 16 Jul 2025.

Method: X-ray diffraction
Resolution: 1.68 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,652
Mol. weight: 37.98 kDa
Released: 16 Jul 2025

Explore 9DDT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DDT contains 13 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
α-helix	19-27	9
β-strand	43-50	8	1
β-strand	54-62	9	1
α-helix	66-68	3
α-helix	71-76	6
β-strand	77-83	7	1
α-helix	93-96	4
α-helix	99-105	7
β-strand	109-114	6	1
α-helix	124-134	11
β-strand	137-140	4	1
α-helix	146-148	3
α-helix	154-156	3
α-helix	158-167	10
β-strand	175-176	2	1

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	2
β-strand	14-19	6	2
α-helix	25-40	16
β-strand	49-52	4	2
β-strand	55-62	8	2
β-strand	65-72	8	2
α-helix	77-95	19
α-helix	100-105	6
α-helix	107-117	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha- and gamma-adaptin-binding protein p34	A	protein	177	Homo sapiens	Q6PD74 (AlphaFold model)
AP-1 complex subunit sigma-3	B	protein	154	Homo sapiens	Q96PC3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9DDT_1 Alpha- and gamma-adaptin-binding protein p34 (chains A)
MAAGVPCALVTSCSSVFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAKAWLPEVMILVCDRVSED
GINRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMK

Sequence of entity 2 (B), FASTA

>9DDT_2 AP-1 complex subunit sigma-3 (chains B)
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYK
RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIG
GEIQETSKKIAVKAIEDSDMLQEVSTVSQTMGER

Primary citation

Structural basis of pseudoGTPase-mediated protein-protein interactions. Wang, B., Yang, R., Wan, C. et al. Structure (2025) 33:1676-1687.e5. DOI 10.1016/j.str.2025.07.009 · PubMed

Other PDB entries of the same protein (UniProt Q6PD74 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DDS 1.78 Å, Crystal structure of human AAGAB G domain with E144K mutation
7TWD 2.11 Å, Structure of AAGAB C-terminal dimerization domain

Browse structure collections

About this viewer

MolViewer shows 9DDT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.