9DYB: CHIP-TPR

CHIP-TPR in complex with the phosphorylated Hsp70 tail. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 Mar 2025.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,270
Mol. weight: 16.86 kDa
Released: 26 Mar 2025

Explore 9DYB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9DYB contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-126	17
β-strand	131	1	1
β-strand	133	1	1
α-helix	134-151	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CHIP	A	protein	139	Homo sapiens	Q9UNE7 (AlphaFold model)
Heat shock 70 kDa protein 1A	B	protein	8	Homo sapiens

Sequence of entity 1 (A), FASTA

>9DYB_1 E3 ubiquitin-protein ligase CHIP (chains A)
GAMGSEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQ
HEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDI
PSALRIAKKKRWNSIEERR

Sequence of entity 2 (B), FASTA

>9DYB_2 Heat shock 70 kDa protein 1A (chains B)
GPTIEEVD

Primary citation

Phosphorylation-State Modulated Binding of HSP70: Structural Insights and Compensatory Protein Engineering. Stewart, M., Paththamperuma, C., McCann, C. et al. bioRxiv (2025). DOI 10.1101/2025.02.17.637997 · PubMed

Other PDB entries of the same protein (UniProt Q9UNE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QFY 1.06 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 9.
6NSV 1.3 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated…
9QFS 1.33 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 8.
9QEU 1.35 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
8EI0 1.47 Å, Crystal structure of the STUB1 TPR domain in complex with H318, a Helicon Polypeptide
6EFK 1.5 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated HSP70…
9QF1 1.51 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 2
8F16 1.56 Å, Structure of the STUB1 TPR domain in complex with H203, an all-D Helicon Polypeptide
8SUV 1.63 Å, CHIP-TPR in complex with the C-terminus of CHIC2
8F14 1.69 Å, Structure of the STUB1 TPR domain in complex with H201, an all-D Helicon Polypeptide
8F15 1.73 Å, Structure of the STUB1 TPR domain in complex with H202, an all-D Helicon Polypeptide

Browse structure collections

About this viewer

MolViewer shows 9DYB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.