9E0I: HKU5-19s RBD

Structure of the HKU5-19s RBD bound to the Bos taurus ACE2 receptor. Determined by electron microscopy at 2.4 Å resolution. Released 19 Feb 2025.

Method: Electron microscopy
Resolution: 2.4 Å
Organisms: Bos taurus, Pipistrellus bat coronavirus HKU5
Chains: 2
Atoms: 6,423
Mol. weight: 121.06 kDa
Ligands: NAG, ZN
Released: 19 Feb 2025

Explore 9E0I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E0I contains 51 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	21-51	31
α-helix	56-80	25
α-helix	85-87	3
α-helix	91-101	11
α-helix	104-107	4
α-helix	110-129	20
β-strand	131-134	4	1
β-strand	139-142	4	1
α-helix	143-147	5
α-helix	148-153	6
α-helix	157-167	11
α-helix	168-172	5
α-helix	173-192	20
α-helix	198-203	6
α-helix	204-206	3
β-strand	208	1	2
α-helix	212-214	3
β-strand	216	1	2
α-helix	218-250	33
β-strand	259	1	3
α-helix	260	1
β-strand	261-262	2	4
α-helix	275-277	3
α-helix	278-281	4
α-helix	288-290	3
α-helix	293-298	6
α-helix	303-316	14
α-helix	319-323	5
α-helix	324-329	6
β-strand	331	1	5
β-strand	346-351	6	5
β-strand	354-358	5	5
α-helix	365-383	19
α-helix	389-391	3
α-helix	399-411	13
α-helix	414-419	6
α-helix	431-445	15
α-helix	449-464	16
α-helix	469-471	3
α-helix	472-479	8
α-helix	480-484	5
β-strand	486-487	2	4
α-helix	499-501	3
α-helix	503-506	4
α-helix	513-531	19
α-helix	538-540	3
α-helix	547-557	11
α-helix	565-573	9
α-helix	581-586	6
α-helix	588-597	10
α-helix	598-600	3
β-strand	606	1	3

Chain B: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	391	1	6
α-helix	395-398	4
β-strand	400	1	7
α-helix	402-404	3
α-helix	405-407	3
β-strand	409-413	5	8
β-strand	416-417	2	6
α-helix	420-424	5
β-strand	428-435	8	8
α-helix	439-442	4
β-strand	447	1	6
β-strand	449-456	8	8
α-helix	459-465	7
α-helix	472	1
α-helix	473-477	5
β-strand	486-492	7	8
β-strand	500	1	7
α-helix	501-503	3
β-strand	505-516	12	9
β-strand	519-522	4	9
α-helix	534-537	4
β-strand	546-549	4	9
β-strand	554-561	8	9
β-strand	567-575	9	8
β-strand	583-584	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiotensin-converting enzyme 2	A	protein	766	Bos taurus	Q58DD0 (AlphaFold model)
Spike glycoprotein	B	protein	267	Pipistrellus bat coronavirus HKU5	A3EXD0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9E0I_1 Angiotensin-converting enzyme 2 (chains A)
MTGSFWLLLSLVAVTAAQSTTEEQAKTFLEKFNHEAEDLSYQSSLASWNYNTNITDENVQ
KMNEARAKWSAFYEEQSRMAKTYSLEEIQNLTLKRQLKALQHSGTSALSAEKSKRLNTIL
NKMSTIYSTGKVLDPNTQECLALEPGLDDIMENSRDYNRRLWAWEGWRAEVGKQLRPLYE
EYVVLENEMARANNYEDYGDYWRGDYEVTGAGDYDYSRDQLMKDVERTFAEIKPLYEQLH
AYVRAKLMHTYPSYISPTGCLPAHLLGDMWGRFWTNLYSLTVPFEHKPSIDVTEKMENQS
WDAERIFKEAEKFFVSISLPYMTQGFWDNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMC
TKVTMDDFLTAHHEMGHIQYDMAYAAQPYLLRNGANEGFHEAVGEIMSLSAATPHYLKAL
GLLAPDFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKQQWMEKWWEMK
REIVGVVEPLPHDETYCDPACLFHVAEDYSFIRYYTRTIYQFQFHEALCKTAKHEGALFK
CDISNSTEAGQRLLQMLRLGKSEPWTLALENIVGIKTMDVKPLLNYFEPLFTWLKEQNRN
SFVGWSTEWTPYSDQSIKVRISLKSALGENAYEWNDNEMYLFQSSVAYAMRKYFSEARNE
TVLFGEDNVWVSDKKPRISFKFFVTSPNNVSDIIPRTEVENAIRLSRDRINDVFQLDDNS
LEFLGIQPTLGPPYEPPVTHHHHHHHHGGSSGLNDIFEAQKIEWHE

Sequence of entity 2 (B), FASTA

>9E0I_2 Spike glycoprotein (chains B)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQECDFTPMLTGTPPPIYNFKRLVFTNCN
YNLTKLLSLFQVSEFSCHQVSPSSLATGCYSSLTVDYFAYSTDMSSYLQPGSAGEIVQFN
YKQDFSNPTCRVLATVPQNLTTITKPSNYAYLTECYKTSAYGKNYLYNAPGGYTPCLSLA
SRGFSTKYQSHSDGELTTTGYIYPVTGNLQMAFIISVQYGTDTNSVCPMQLVPRGSSSGG
SGLNDIFEAQKIEWHEGGSHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
ZN	Zinc ion	Zn	1

Primary citation

Molecular basis of convergent evolution of ACE2 receptor utilization among HKU5 coronaviruses. Park, Y.J., Liu, C., Lee, J. et al. Cell (2025) 188:1711-1728.e21. DOI 10.1016/j.cell.2024.12.032 · PubMed

Other PDB entries of the same protein (UniProt Q58DD0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HFX 2.98 Å, Cryo-EM structure of SARS-CoV-2 Omicron BA.1 spike protein in complex with white-tailed…
8HFY 3.21 Å, SARS-CoV-2 Omicron BA.1 spike protein receptor-binding domain in complex with…
8XZ9 3.37 Å, BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2)
8HG0 3.51 Å, Cryo-EM structure of SARS-CoV-2 prototype spike protein receptor-binding domain in…
9KOW 3.98 Å, Crystal structure of RaTG13 RBD complexed with cattle ACE2

Browse structure collections

About this viewer

MolViewer shows 9E0I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.