9KOW: RaTG13 RBD

Crystal structure of RaTG13 RBD complexed with cattle ACE2. Determined by X-ray diffraction at 3.98 Å resolution. Released 26 Nov 2025.

Method: X-ray diffraction
Resolution: 3.98 Å
Organisms: Bos taurus, Bat coronavirus RaTG13
Chains: 2
Atoms: 6,483
Mol. weight: 92.33 kDa
Ligands: NAG
Released: 26 Nov 2025

Explore 9KOW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9KOW contains 46 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	22-53	32
α-helix	56-82	27
α-helix	85-87	3
α-helix	91-100	10
α-helix	104-107	4
α-helix	110-129	20
β-strand	132-133	2	1
β-strand	140-141	2	1
α-helix	143-147	5
α-helix	148-153	6
α-helix	157-166	10
α-helix	167-171	5
α-helix	172-191	20
α-helix	198-203	6
β-strand	208	1	2
β-strand	216	1	2
α-helix	220-250	31
α-helix	252-254	3
α-helix	260	1
β-strand	261-262	2	3
α-helix	263-265	3
α-helix	275-277	3
α-helix	278-281	4
α-helix	288-289	2
α-helix	293-298	6
α-helix	303-316	14
α-helix	319-323	5
α-helix	324-329	6
β-strand	331	1	4
β-strand	346-351	6	4
β-strand	354-358	5	4
α-helix	365-383	19
α-helix	384-386	3
α-helix	399-411	13
α-helix	414-419	6
α-helix	431-464	34
α-helix	469-471	3
α-helix	472-482	11
β-strand	486-487	2	3
α-helix	503-506	4
α-helix	513-531	19
α-helix	547-557	11
α-helix	565-573	9
α-helix	581-597	17
α-helix	598-600	3

Chain E: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	339-342	4
α-helix	347-348	2
β-strand	349	1	5
α-helix	350-352	3
β-strand	354-358	5	5
β-strand	361-362	2	6
α-helix	365-370	6
β-strand	376-379	4	5
β-strand	392	1	6
β-strand	394-401	8	5
α-helix	404-409	6
α-helix	417-421	5
β-strand	432-437	6	5
α-helix	439-442	4
β-strand	452-454	3	7
α-helix	460-462	3
β-strand	473-474	2	8
β-strand	485	1	8
β-strand	488-489	2	8
β-strand	492-494	3	7
α-helix	503-505	3
β-strand	508-516	9	5
α-helix	521-522	2
β-strand	524-525	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Processed angiotensin-converting enzyme 2	A	protein	596	Bos taurus	Q58DD0 (AlphaFold model)
RaTG13 rbd	E	protein	194	Bat coronavirus RaTG13	A0ABF7PLN6

Sequence of entity 1 (A), FASTA

>9KOW_1 Processed angiotensin-converting enzyme 2 (chains A)
STTEEQAKTFLEKFNHEAEDLSYQSSLASWNYNTNITDENVQKMNEARAKWSAFYEEQSR
MAKTYSLEEIQNLTLKRQLKALQHSGTSALSAEKSKRLNTILNKMSTIYSTGKVLDPNTQ
ECLALEPGLDDIMENSRDYNRRLWAWEGWRAEVGKQLRPLYEEYVVLENEMARANNYEDY
GDYWRGDYEVTGAGDYDYSRDQLMKDVERTFAEIKPLYEQLHAYVRAKLMHTYPSYISPT
GCLPAHLLGDMWGRFWTNLYSLTVPFEHKPSIDVTEKMENQSWDAERIFKEAEKFFVSIS
LPYMTQGFWDNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMCTKVTMDDFLTAHHEMGHI
QYDMAYAAQPYLLRNGANEGFHEAVGEIMSLSAATPHYLKALGLLAPDFHEDNETEINFL
LKQALTIVGTLPFTYMLEKWRWMVFKGEIPKQQWMEKWWEMKREIVGVVEPLPHDETYCD
PACLFHVAEDYSFIRYYTRTIYQFQFHEALCKTAKHEGALFKCDISNSTEAGQRLLQMLR
LGKSEPWTLALENIVGIKTMDVKPLLNYFEPLFTWLKEQNRNSFVGWSTEWTPYSD

Sequence of entity 2 (E), FASTA

>9KOW_2 RaTG13 RBD (chains E)
TNLCPFGEVFNATTFASVYAWNRKRISNCVADYSVLYNSTSFSTFKCYGVSPTKLNDLCF
TNVYADSFVITGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSKHIDAKEGGNFNYL
YRLFRKANLKPFERDISTEIYQAGSKPCNGQTGLNCYYPLYRYGFYPTDGVGHQPYRVVV
LSFELLNAPATVCG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Crystal structure of RaTG13 RBD complexed with cattle ACE2. Lan, J., Wang, C.H. To be published.

Other PDB entries of the same protein (UniProt Q58DD0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E0I 2.4 Å, Structure of the HKU5-19s RBD bound to the Bos taurus ACE2 receptor
8HFX 2.98 Å, Cryo-EM structure of SARS-CoV-2 Omicron BA.1 spike protein in complex with white-tailed…
8HFY 3.21 Å, SARS-CoV-2 Omicron BA.1 spike protein receptor-binding domain in complex with…
8XZ9 3.37 Å, BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2)
8HG0 3.51 Å, Cryo-EM structure of SARS-CoV-2 prototype spike protein receptor-binding domain in…

Browse structure collections

About this viewer

MolViewer shows 9KOW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.