9E4C: Acid-sensing ion channel 1

Human ASIC1a at pH 7.5 with partial transmembrane domain. Determined by electron microscopy at 3.41 Å resolution. Released 21 Jan 2026.

Method

Electron microscopy

Resolution

3.41 Å

Organism

Homo sapiens

Chains

3

Atoms

9,729

Mol. weight

180.76 kDa

Released

21 Jan 2026

Explore 9E4C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E4C contains 73 α-helices and 64 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 22 β-strands

Molecules and chains

>9E4C_1 Acid-sensing ion channel 1 (chains A, B, C)
GGRMELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVL
LCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLAL
LNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGE
VCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETD
ETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDS
DLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKD
QEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNY
ETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKR
SSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

Primary citation

Conformational plasticity of human acid-sensing ion channel 1a. Cahill, J., Hartfield, K.A., Heusser, S.A. et al. Nat Struct Mol Biol (2026) 33:1171-1182. DOI 10.1038/s41594-026-01845-0 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P78348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 9E4I 2.33 Å, Human ASIC1a at pH 7.5 in complex with MitTx
• 9E4H 2.61 Å, Human ASIC1a at pH 5.7 with rotated, domain-swapped transmembrane domain
• 9E4F 2.69 Å, Human ASIC1a at pH 5.7 with domain-swapped transmembrane domain
• 9E4A 2.74 Å, Human ASIC1a at pH 8.5 with domain-swapped transmembrane domain
• 9E4K 2.77 Å, Human ASIC1a at pH 8.5, T26V mutation
• 9E4G 2.8 Å, Human ASIC1a at pH 5.7 with linear transmembrane domain
• 6L6N 2.86 Å, hASIC1a co-crystallized with Nafamostat
• 7RNN 2.86 Å, Human ASIC1a-Nb.C1 complex
• 9E4J 2.87 Å, Human ASIC1a at pH 6.5 in complex with MitTx
• 9E4B 3.09 Å, Human ASIC1a at pH 7.5 with domain-swapped transmembrane domain
• 9E4E 3.16 Å, Human ASIC1a at pH 6.5 with linear transmembrane domain
• 9E4D 3.19 Å, Human ASIC1a at pH 7.5 with linear transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 9E4C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.