9E4I: Human ASIC1a at pH 7.5
Human ASIC1a at pH 7.5 in complex with MitTx. Determined by electron microscopy at 2.33 Å resolution. Released 21 Jan 2026.
- Method
- Electron microscopy
- Resolution
- 2.33 Å
- Organisms
- Homo sapiens, Micrurus tener tener
- Chains
- 9
- Atoms
- 14,241
- Mol. weight
- 243.41 kDa
- Released
- 21 Jan 2026
Explore 9E4I in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9E4I contains 116 α-helices and 90 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 27 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-68 | 28 | |
| β-strand | 73-80 | 8 | 1 |
| β-strand | 85-86 | 2 | 2 |
| α-helix | 87-88 | 2 | |
| β-strand | 89-94 | 6 | 3 |
| β-strand | 99 | 1 | 4 |
| α-helix | 105-111 | 7 | |
| α-helix | 127-129 | 3 | |
| α-helix | 132-141 | 10 | |
| α-helix | 154-161 | 8 | |
| α-helix | 163-164 | 2 | |
| α-helix | 165-168 | 4 | |
| β-strand | 169-174 | 6 | 1 |
| β-strand | 177-178 | 2 | 1 |
| α-helix | 181-183 | 3 | |
| β-strand | 184-189 | 6 | 3 |
| β-strand | 192-197 | 6 | 3 |
| α-helix | 200-202 | 3 | |
| α-helix | 205-207 | 3 | |
| β-strand | 208-209 | 2 | 2 |
| α-helix | 214-216 | 3 | |
| β-strand | 218-223 | 6 | 1 |
| α-helix | 226-228 | 3 | |
| β-strand | 229 | 1 | 4 |
| α-helix | 230-232 | 3 | |
| β-strand | 243 | 1 | 5 |
| β-strand | 245-250 | 6 | 3 |
| α-helix | 258-261 | 4 | |
| β-strand | 263-265 | 3 | 3 |
| β-strand | 269-281 | 13 | 1 |
| α-helix | 283-284 | 2 | |
| β-strand | 291 | 1 | 6 |
| α-helix | 307-323 | 17 | |
| β-strand | 326 | 1 | 7 |
| α-helix | 335 | 1 | |
| β-strand | 336 | 1 | 7 |
| α-helix | 337-338 | 2 | |
| α-helix | 339-341 | 3 | |
| α-helix | 342-346 | 5 | |
| α-helix | 347-351 | 5 | |
| α-helix | 352-356 | 5 | |
| α-helix | 363-365 | 3 | |
| β-strand | 366 | 1 | 6 |
| β-strand | 368-380 | 13 | 1 |
| α-helix | 387-393 | 7 | |
| α-helix | 398-404 | 7 | |
| β-strand | 405-412 | 8 | 1 |
| β-strand | 417-424 | 8 | 1 |
| α-helix | 428-450 | 23 | |
Chain B: 29 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 42-69 | 28 | |
| β-strand | 73-80 | 8 | 5 |
| β-strand | 85-86 | 2 | 8 |
| α-helix | 87-88 | 2 | |
| β-strand | 89-94 | 6 | 9 |
| β-strand | 99 | 1 | 10 |
| α-helix | 100-102 | 3 | |
| α-helix | 105-111 | 7 | |
| α-helix | 132-141 | 10 | |
| α-helix | 149-151 | 3 | |
| α-helix | 154-161 | 8 | |
| α-helix | 163-164 | 2 | |
| α-helix | 165-168 | 4 | |
| β-strand | 169-174 | 6 | 5 |
| β-strand | 177-178 | 2 | 5 |
| α-helix | 181-183 | 3 | |
| β-strand | 184-189 | 6 | 9 |
| β-strand | 192-197 | 6 | 9 |
| α-helix | 200-202 | 3 | |
| α-helix | 205-207 | 3 | |
| β-strand | 208-209 | 2 | 8 |
| α-helix | 214-216 | 3 | |
| β-strand | 218-223 | 6 | 5 |
| α-helix | 226-228 | 3 | |
| β-strand | 229 | 1 | 10 |
| α-helix | 230-231 | 2 | |
| β-strand | 243 | 1 | 11 |
| β-strand | 245-250 | 6 | 9 |
| α-helix | 258-261 | 4 | |
| β-strand | 263-265 | 3 | 9 |
| β-strand | 269-281 | 13 | 5 |
| α-helix | 283-284 | 2 | |
| β-strand | 291 | 1 | 12 |
| α-helix | 307-323 | 17 | |
| β-strand | 326 | 1 | 13 |
| α-helix | 335 | 1 | |
| β-strand | 336 | 1 | 13 |
| α-helix | 337-338 | 2 | |
| α-helix | 339-341 | 3 | |
| α-helix | 342-346 | 5 | |
| α-helix | 347-351 | 5 | |
| α-helix | 352-356 | 5 | |
| α-helix | 363-365 | 3 | |
| β-strand | 366 | 1 | 12 |
| β-strand | 368-380 | 13 | 5 |
| α-helix | 387-393 | 7 | |
| α-helix | 398-404 | 7 | |
| β-strand | 405-412 | 8 | 5 |
| β-strand | 417-424 | 8 | 5 |
| α-helix | 428-446 | 19 | |
| α-helix | 448-451 | 4 | |
Chain C: 27 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 43-69 | 27 | |
| β-strand | 73-80 | 8 | 11 |
| β-strand | 85-86 | 2 | 14 |
| α-helix | 87-88 | 2 | |
| β-strand | 89-94 | 6 | 15 |
| β-strand | 99 | 1 | 16 |
| α-helix | 105-111 | 7 | |
| α-helix | 127-129 | 3 | |
| α-helix | 132-141 | 10 | |
| α-helix | 154-161 | 8 | |
| α-helix | 163-164 | 2 | |
| α-helix | 165-168 | 4 | |
| β-strand | 169-174 | 6 | 11 |
| β-strand | 177-178 | 2 | 11 |
| α-helix | 181-183 | 3 | |
| β-strand | 184-189 | 6 | 15 |
| β-strand | 192-197 | 6 | 15 |
| α-helix | 200-202 | 3 | |
| α-helix | 204-207 | 4 | |
| β-strand | 208-209 | 2 | 14 |
| α-helix | 214-216 | 3 | |
| β-strand | 218-223 | 6 | 11 |
| α-helix | 226-228 | 3 | |
| β-strand | 229 | 1 | 16 |
| α-helix | 230-231 | 2 | |
| β-strand | 243 | 1 | 1 |
| β-strand | 245-250 | 6 | 15 |
| α-helix | 258-261 | 4 | |
| β-strand | 263-265 | 3 | 15 |
| β-strand | 269-281 | 13 | 11 |
| α-helix | 283-284 | 2 | |
| β-strand | 291 | 1 | 17 |
| α-helix | 307-323 | 17 | |
| β-strand | 326 | 1 | 18 |
| α-helix | 335 | 1 | |
| β-strand | 336 | 1 | 18 |
| α-helix | 337-338 | 2 | |
| α-helix | 339-341 | 3 | |
| α-helix | 342-346 | 5 | |
| α-helix | 347-351 | 5 | |
| α-helix | 352-356 | 5 | |
| α-helix | 363-365 | 3 | |
| β-strand | 366 | 1 | 17 |
| β-strand | 368-380 | 13 | 11 |
| α-helix | 387-393 | 7 | |
| α-helix | 398-404 | 7 | |
| β-strand | 405-412 | 8 | 11 |
| β-strand | 417-424 | 8 | 11 |
| α-helix | 428-450 | 23 | |
Chain D: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-8 | 4 | |
| α-helix | 10-11 | 2 | |
| β-strand | 21-27 | 7 | 19 |
| β-strand | 32-38 | 7 | 19 |
| β-strand | 48 | 1 | 19 |
| α-helix | 51-54 | 4 | |
| α-helix | 55-59 | 5 | |
Chains E and I: 8 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-12 | 11 | |
| α-helix | 17-20 | 4 | |
| β-strand | 23 | 1 | 20 |
| β-strand | 27 | 1 | 20 |
| α-helix | 38-52 | 15 | |
| α-helix | 53-57 | 5 | |
| β-strand | 69 | 1 | 21 |
| α-helix | 74-76 | 3 | |
| β-strand | 78 | 1 | 21 |
| α-helix | 85-103 | 19 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 20 |
| α-helix | 115-117 | 3 | |
Chains F and H: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-8 | 4 | |
| α-helix | 10-11 | 2 | |
| β-strand | 21-27 | 7 | 22 |
| β-strand | 32-38 | 7 | 22 |
| β-strand | 48 | 1 | 22 |
| α-helix | 51-58 | 8 | |
Chain G: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-12 | 11 | |
| α-helix | 17-20 | 4 | |
| β-strand | 23 | 1 | 23 |
| β-strand | 27 | 1 | 23 |
| α-helix | 38-55 | 18 | |
| β-strand | 69 | 1 | 24 |
| α-helix | 74-76 | 3 | |
| β-strand | 78 | 1 | 24 |
| α-helix | 85-103 | 19 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 23 |
| α-helix | 115-117 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acid-sensing ion channel 1 | A, B, C | protein | 531 | Homo sapiens | P78348 (AlphaFold model) |
| Kunitz-type neurotoxin MitTx-alpha | D, F, H | protein | 60 | Micrurus tener tener | G9I929 (AlphaFold model) |
| Basic phospholipase A2 homolog MitTx-beta | E, G, I | protein | 119 | Micrurus tener tener | G9I930 (AlphaFold model) |
Sequence of entity 1 (A, B, C), FASTA
>9E4I_1 Acid-sensing ion channel 1 (chains A, B, C)
GGRMELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVL
LCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLAL
LNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGE
VCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETD
ETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDS
DLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKD
QEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNY
ETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKR
SSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
Sequence of entity 2 (D, F, H), FASTA
>9E4I_2 Kunitz-type neurotoxin MitTx-alpha (chains D, F, H)
QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG
Sequence of entity 3 (E, G, I), FASTA
>9E4I_3 Basic phospholipase A2 homolog MitTx-beta (chains E, G, I)
NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCK
PLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ
Primary citation
Conformational plasticity of human acid-sensing ion channel 1a. Cahill, J., Hartfield, K.A., Heusser, S.A. et al. Nat Struct Mol Biol (2026) 33:1171-1182. DOI 10.1038/s41594-026-01845-0 · PubMed
Other PDB entries of the same protein (UniProt P78348 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9E4H 2.61 Å, Human ASIC1a at pH 5.7 with rotated, domain-swapped transmembrane domain
- 9E4F 2.69 Å, Human ASIC1a at pH 5.7 with domain-swapped transmembrane domain
- 9E4A 2.74 Å, Human ASIC1a at pH 8.5 with domain-swapped transmembrane domain
- 9E4K 2.77 Å, Human ASIC1a at pH 8.5, T26V mutation
- 9E4G 2.8 Å, Human ASIC1a at pH 5.7 with linear transmembrane domain
- 6L6N 2.86 Å, hASIC1a co-crystallized with Nafamostat
- 7RNN 2.86 Å, Human ASIC1a-Nb.C1 complex
- 9E4J 2.87 Å, Human ASIC1a at pH 6.5 in complex with MitTx
- 9E4B 3.09 Å, Human ASIC1a at pH 7.5 with domain-swapped transmembrane domain
- 9E4E 3.16 Å, Human ASIC1a at pH 6.5 with linear transmembrane domain
- 9E4D 3.19 Å, Human ASIC1a at pH 7.5 with linear transmembrane domain
- 6L6I 3.24 Å, hASIC1a co-crystallized with Mamb-1
Browse structure collections
About this viewer
MolViewer shows 9E4I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.