9E4K: Human ASIC1a at pH 8.5, T26V mutation

Human ASIC1a at pH 8.5, T26V mutation. Determined by electron microscopy at 2.77 Å resolution. Released 21 Jan 2026.

Method

Electron microscopy

Resolution

2.77 Å

Organism

Homo sapiens

Chains

3

Atoms

9,915

Mol. weight

180.75 kDa

Released

21 Jan 2026

Explore 9E4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E4K contains 71 α-helices and 60 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 20 β-strands

Molecules and chains

>9E4K_1 Acid-sensing ion channel 1 (chains A, B, C)
GGRMELKAEEEEVGGVQPVSIQAFASSSVLHGLAHIFSYERLSLKRALWALCFLGSLAVL
LCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLAL
LNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGE
VCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETD
ETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDS
DLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKD
QEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNY
ETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKR
SSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

Primary citation

Conformational plasticity of human acid-sensing ion channel 1a. Cahill, J., Hartfield, K.A., Heusser, S.A. et al. Nat Struct Mol Biol (2026) 33:1171-1182. DOI 10.1038/s41594-026-01845-0 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P78348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 9E4I 2.33 Å, Human ASIC1a at pH 7.5 in complex with MitTx
• 9E4H 2.61 Å, Human ASIC1a at pH 5.7 with rotated, domain-swapped transmembrane domain
• 9E4F 2.69 Å, Human ASIC1a at pH 5.7 with domain-swapped transmembrane domain
• 9E4A 2.74 Å, Human ASIC1a at pH 8.5 with domain-swapped transmembrane domain
• 9E4G 2.8 Å, Human ASIC1a at pH 5.7 with linear transmembrane domain
• 6L6N 2.86 Å, hASIC1a co-crystallized with Nafamostat
• 7RNN 2.86 Å, Human ASIC1a-Nb.C1 complex
• 9E4J 2.87 Å, Human ASIC1a at pH 6.5 in complex with MitTx
• 9E4B 3.09 Å, Human ASIC1a at pH 7.5 with domain-swapped transmembrane domain
• 9E4E 3.16 Å, Human ASIC1a at pH 6.5 with linear transmembrane domain
• 9E4D 3.19 Å, Human ASIC1a at pH 7.5 with linear transmembrane domain
• 6L6I 3.24 Å, hASIC1a co-crystallized with Mamb-1

Browse structure collections

About this viewer

MolViewer shows 9E4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.