Cryo-EM structure of mechanosensitive channel YnaI in DDPC nanodiscs. Determined by electron microscopy at 2.3 Å resolution. Released 27 Aug 2025.
Explore 9E67 in 3D Show helices and sheets RCSB PDB PDBe
9E67 contains 91 α-helices and 84 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-11 | 6 | |
| α-helix | 16-31 | 16 | |
| α-helix | 41-67 | 27 | |
| α-helix | 75-108 | 34 | |
| α-helix | 112-134 | 23 | |
| α-helix | 142-159 | 18 | |
| α-helix | 161-175 | 15 | |
| β-strand | 184-185 | 2 | 1 |
| β-strand | 186 | 1 | 2 |
| β-strand | 194-199 | 6 | 1 |
| β-strand | 203-207 | 5 | 1 |
| β-strand | 213-217 | 5 | 1 |
| α-helix | 218-222 | 5 | |
| β-strand | 226-227 | 2 | 2 |
| α-helix | 229-231 | 3 | |
| β-strand | 235-243 | 9 | 3 |
| α-helix | 245-247 | 3 | |
| α-helix | 251-262 | 12 | |
| β-strand | 268 | 1 | 3 |
| β-strand | 275-281 | 7 | 3 |
| β-strand | 286-294 | 9 | 3 |
| α-helix | 299-319 | 21 | |
| β-strand | 324 | 1 | 3 |
| α-helix | 325-327 | 3 | |
| β-strand | 328-333 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-11 | 6 | |
| α-helix | 16-31 | 16 | |
| α-helix | 41-67 | 27 | |
| α-helix | 75-108 | 34 | |
| α-helix | 112-133 | 22 | |
| α-helix | 142-159 | 18 | |
| α-helix | 161-175 | 15 | |
| β-strand | 184-185 | 2 | 7 |
| β-strand | 186 | 1 | 5 |
| β-strand | 194-199 | 6 | 7 |
| β-strand | 203-207 | 5 | 7 |
| β-strand | 213-217 | 5 | 7 |
| α-helix | 218-222 | 5 | |
| β-strand | 226-227 | 2 | 5 |
| α-helix | 229-231 | 3 | |
| β-strand | 235-243 | 9 | 8 |
| α-helix | 245-247 | 3 | |
| α-helix | 251-264 | 14 | |
| β-strand | 268 | 1 | 8 |
| β-strand | 275-281 | 7 | 8 |
| β-strand | 286-294 | 9 | 8 |
| α-helix | 299-319 | 21 | |
| β-strand | 324 | 1 | 8 |
| α-helix | 325-327 | 3 | |
| β-strand | 328-333 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-11 | 6 | |
| α-helix | 16-31 | 16 | |
| α-helix | 41-67 | 27 | |
| α-helix | 75-108 | 34 | |
| α-helix | 112-134 | 23 | |
| α-helix | 142-159 | 18 | |
| α-helix | 161-175 | 15 | |
| β-strand | 184-185 | 2 | 9 |
| β-strand | 186 | 1 | 7 |
| β-strand | 194-199 | 6 | 9 |
| β-strand | 203-207 | 5 | 9 |
| β-strand | 213-217 | 5 | 9 |
| α-helix | 218-222 | 5 | |
| β-strand | 226-227 | 2 | 7 |
| α-helix | 229-231 | 3 | |
| β-strand | 235-243 | 9 | 10 |
| α-helix | 245-247 | 3 | |
| α-helix | 251-264 | 14 | |
| β-strand | 268 | 1 | 10 |
| β-strand | 275-281 | 7 | 10 |
| β-strand | 286-294 | 9 | 10 |
| α-helix | 299-319 | 21 | |
| β-strand | 324 | 1 | 10 |
| α-helix | 325-327 | 3 | |
| β-strand | 328-333 | 6 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Low conductance mechanosensitive channel YnaI | A, B, C, D, E, F, G | protein | 351 | Escherichia coli | P0AEB5 (AlphaFold model) |
>9E67_1 Low conductance mechanosensitive channel YnaI (chains A, B, C, D, E, F, G) MIAELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSI INYVIENYKLKFITPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSR IIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFS IGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTT IGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWA EWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMDNITPPEQGRAAHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| PTY | Phosphatidylethanolamine | C40 H80 N O8 P | 35 |
Lipid interactions and gating hysteresis suggest a physiological role for mechanosensitive channel YnaI. Will, N., Hiotis, G., Nakayama, Y. et al. Nat Commun (2025) 16:7472-7472. DOI 10.1038/s41467-025-62805-8 · PubMed
Other PDB entries of the same protein (UniProt P0AEB5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9E67 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.