9H95: Low conductance mechanosensitive channel YnaI

YnaI in closed conformation purified in DDM with additional lipids showing ligand-filled pockets. Determined by electron microscopy at 2.2 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 2.2 Å
Organism: Escherichia coli
Chains: 7
Atoms: 19,201
Mol. weight: 288.34 kDa
Ligands: D12
Released: 24 Sept 2025

Explore 9H95 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9H95 contains 84 α-helices and 84 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F and G: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	10-31	22
α-helix	40-68	29
α-helix	77-107	31
α-helix	112-133	22
α-helix	143-159	17
α-helix	161-175	15
β-strand	184-185	2	1
β-strand	186	1	2
β-strand	194-199	6	1
β-strand	203-207	5	1
β-strand	213-217	5	1
α-helix	218-222	5
β-strand	226-227	2	2
α-helix	229-231	3
β-strand	235-243	9	3
α-helix	245-250	6
α-helix	251-263	13
β-strand	268	1	3
β-strand	275-281	7	3
β-strand	286-294	9	3
α-helix	299-319	21
β-strand	324	1	3
β-strand	328-333	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low conductance mechanosensitive channel YnaI	A, B, C, D, E, F, G	protein	351	Escherichia coli	P0AEB5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>9H95_1 Low conductance mechanosensitive channel YnaI (chains A, B, C, D, E, F, G)
MIAELFTNNALNLVIIFGSCAALILMSFWFRRGNRKRKGFLFHAVQFLIYTIIISAVGSI
INYVIENYKLKFITPGVIDFICTSLIAVILTIKLFLLINQFEKQQIKKGRDITSARIMSR
IIKITIIVVLVLLYGEHFGMSLSGLLTFGGIGGLAVGMAGKDILSNFFSGIMLYFDRPFS
IGDWIRSPDRNIEGTVAEIGWRITKITTFDNRPLYVPNSLFSSISVENPGRMTNRRITTT
IGLRYEDAAKVGVIVEAVREMLKNHPAIDQRQTLLVYFNQFADSSLNIMVYCFTKTTVWA
EWLAAQQDVYLKIIDIVQSHGADFAFPSQTLYMDNITPPEQGRLEENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
D12	Dodecane	C12 H26	56

Primary citation

Mechanosensitive channel engineering: A study on the mixing and matching of YnaI and MscS sensor paddles and pores. Flegler, V.J., Rasmussen, A., Hedrich, R. et al. Nat Commun (2025) 16:7881-7881. DOI 10.1038/s41467-025-63253-0 · PubMed

Other PDB entries of the same protein (UniProt P0AEB5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E63 2.3 Å, Cryo-EM structure of mechanosensitive channel YnaI in DOPC nanodiscs treated with…
9E67 2.3 Å, Cryo-EM structure of mechanosensitive channel YnaI in DDPC nanodiscs
9H2P 2.3 Å, YnaI in its open conformation purified in DDM showing ligand-filled pockets
7N4T 2.4 Å, Low conductance mechanosensitive channel YnaI
9E62 2.5 Å, Cryo-EM structure of mechanosensitive channel YnaI in DOPC nanodiscs
9E68 2.5 Å, Cryo-EM structure of MscS/YnaI chimera in DOPC nanodiscs
9H2S 2.7 Å, a YnaI-MscS chimera in a closed conformation purified in DDM with additional lipids…
9E65 2.8 Å, Cryo-EM structure of mechanosensitive channel YnaI A155V mutant in conformation 1
9E66 2.8 Å, Cryo-EM structure of mechanosensitive channel YnaI A155V mutant in conformation 2
9H2V 2.8 Å, a YnaI-MscS chimera in an open conformation purified in DDM showing ligand-filled pockets
6ZYD 3.0 Å, YnaI
9E64 3.0 Å, Cryo-EM structure of mechanosensitive channel YnaI in DOPC nanodiscs treated with…

Browse structure collections

About this viewer

MolViewer shows 9H95 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.