9E6J: DH726-1 Fab

DH726-1 Fab bound to hemagglutinin from influenza A/Solomon Islands/3/2006. Determined by electron microscopy at 2.98 Å resolution. Released 21 Jan 2026.

Method: Electron microscopy
Resolution: 2.98 Å
Organisms: Alphainfluenzavirus influenzae, Macaca mulatta
Chains: 9
Atoms: 16,743
Mol. weight: 321.33 kDa
Released: 21 Jan 2026

Explore 9E6J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9E6J contains 57 α-helices and 219 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 15 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
β-strand	12	1	2
β-strand	18-20	3	3
β-strand	28-30	3	3
β-strand	33-35	3	4
β-strand	37-38	2	5
β-strand	45-48	4	6
β-strand	51	1	6
α-helix	52-53	2
β-strand	54-55	2	7
β-strand	59	1	8
α-helix	61-66	6
β-strand	80	1	9
β-strand	83-85	3	7
β-strand	91	1	8
β-strand	99	1	9
α-helix	102-109	8
β-strand	112-119	8	9
α-helix	123-126	4
β-strand	131	1	10
β-strand	136-141	6	11
β-strand	144-146	3	11
β-strand	151-153	3	9
β-strand	155	1	10
β-strand	157	1	12
β-strand	160	1	12
β-strand	164-169	6	13
β-strand	175-184	10	9
α-helix	188-195	8
β-strand	202-205	4	13
β-strand	210-213	4	13
α-helix	220-222	3
β-strand	223	1	14
β-strand	226	1	14
β-strand	229-237	9	9
α-helix	238	1
β-strand	242-247	6	13
β-strand	251-254	4	9
β-strand	256-262	7	9
β-strand	268-270	3	7
α-helix	273-274	2
β-strand	275-280	6	6
β-strand	282-283	2	15
β-strand	288-289	2	15
β-strand	295-296	2	5
β-strand	303-304	2	15
α-helix	306-307	2
β-strand	308-309	2	5
β-strand	316-318	3	4
β-strand	322	1	3
β-strand	343	1	2
β-strand	351-356	6	1
β-strand	361-365	5	1
α-helix	367-386	20
α-helix	390-392	3
β-strand	393-394	2	15
α-helix	404-455	52
α-helix	456-458	3
β-strand	459-461	3	1
β-strand	466-469	4	1
α-helix	475-482	8
α-helix	488-500	13

Chains H, I and J: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	16
β-strand	11-12	2	17
β-strand	18-25	8	16
α-helix	29-31	3
β-strand	34-39	6	18
β-strand	45-51	7	18
β-strand	54	1	1
β-strand	57-59	3	18
β-strand	67-72	6	16
β-strand	77-82	6	16
α-helix	84-86	3
β-strand	88-95	8	18
β-strand	98-100	3	19
β-strand	100C-100E	3	19
β-strand	100J-103	4	18
β-strand	107-109	3	18
β-strand	110-111	2	17

Chains L, M and N: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	20
β-strand	10-12	3	21
β-strand	19-25	7	20
β-strand	33-38	6	21
β-strand	45-48	4	21
β-strand	54	1	21
β-strand	62-67	6	20
β-strand	70-75	6	20
α-helix	80-82	3
β-strand	85-90	6	21
α-helix	96	1
β-strand	97-98	2	21
β-strand	102-105	4	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin	A, B, C	protein	520	Alphainfluenzavirus influenzae	A7UPX0
DH726-1 Fab heavy chain	H, I, J	protein	241	Macaca mulatta
DH726-1 Fab light chain	L, M, N	protein	214	Macaca mulatta

Sequence of entity 1 (A, B, C), FASTA

>9E6J_1 Hemagglutinin (chains A, B, C)
ADPGYLLEDTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCLLKGIAPLQL
GNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFE
RFEIFPKESSWPNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEV
LVLWGVHHPPNIGDQRALYHTENAYVSVVSSHYSRKFTPEIAKRPKVRDREGRINYYWTL
LEPGDTIIFEANGNLIAPRYAFALSRGFGSGIINSNAPMDECDAKCQTPQGAINSSLPFQ
NVHPVTIGECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHH
QNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKLERRMENLNKKVDD
GFIDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVKSQLKNNAKEIGNGCFEFYHKCND
ECMESVKNGTYDYPKYSEESKLNREKIDGVRSGALEVLFQ

Sequence of entity 2 (H, I, J), FASTA

>9E6J_2 DH726-1 Fab heavy chain (chains H, I, J)
EVQLVESGGGLVQPGGSLRLSCVASGFTFSNYAMYWVRQAPGKGLEWISSINSGSGSRYY
ADSVKGRFTVSRDNSKNTLSLQMNSLRVEDTAVYYCAKDQSNPIFGLVIATNSLDVWGQG
VLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGSSLEVLF
Q

Sequence of entity 3 (L, M, N), FASTA

>9E6J_3 DH726-1 Fab light chain (chains L, M, N)
DIQMTQSPSSLSASVGDTVTISCRASQGISSDLAWYQQKPGKAPKLLIYKASTLQSGVPP
RFGGRGSGPDFTLTISSLQPEDFATYYCQQHNSYPLTFGGGTKVEVKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Elicitation of stem-directed antibodies in rhesus macaques by a conventional hemagglutinin immunogen. Gu, S., Finney, J., Luo, K. et al. bioRxiv (2026). DOI 10.64898/2026.07.16.738984 · PubMed

Other PDB entries of the same protein (UniProt A7UPX0), best resolution first:

5W0D 1.9 Å, Inferred precursor (UCA) of the human antibody lineage K03.12 in complex with influenza…
4HKX 2.5 Å, Influenza hemagglutinin in complex with CH67 Fab
4YJZ 2.72 Å, Human antibody H2526 in complex with influenza hemagglutinin H1 Solomon Islands/03/2006
5W6G 2.79 Å, Human antibody 6649 in complex with influenza hemagglutinin H1 Solomon Islands
4YK4 2.8 Å, Human antibody 641 I-9 in complex with influenza hemagglutinin H1 Solomon Islands/03/2006
6Q0O 3.0 Å, human antibody H2227 lineage 652 in complex with influenza hemagglutinin head domain of…
5UG0 3.4 Å, Human antibody H2897 in complex with influenza hemagglutinin H1 Solomon Islands/03/2006
6WIZ 4.2 Å, Crystal structure of Fab 54-1G05 bound to H1 influenza hemagglutinin
5UJZ 4.8 Å, CryoEM structure of an influenza virus receptor-binding site antibody-antigen interface…
5UK0 4.8 Å, CryoEM structure of an influenza virus receptor-binding site antibody-antigen interface…
5UK1 4.8 Å, CryoEM structure of an influenza virus receptor-binding site antibody-antigen interface…
5UK2 4.8 Å, CryoEM structure of an influenza virus receptor-binding site antibody-antigen interface…

Browse structure collections

About this viewer

MolViewer shows 9E6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.