9EAM: Coronin-7 CA

Coronin-7 CA bound to Arp2/3 complex. Determined by electron microscopy at 2.97 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 2.97 Å
Organisms: Bos taurus, Homo sapiens
Chains: 8
Atoms: 15,778
Mol. weight: 230.21 kDa
Ligands: ATP, MG
Released: 19 Nov 2025

Explore 9EAM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EAM contains 89 α-helices and 91 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	16-21	6	1
β-strand	29-32	4	1
β-strand	35-37	3	2
α-helix	50-51	2
β-strand	60-62	3	2
α-helix	63-65	3
β-strand	73-75	3	2
β-strand	78	1	3
β-strand	83	1	3
α-helix	86-95	10
α-helix	96-101	6
β-strand	110-114	5	1
α-helix	120-132	13
β-strand	139-143	5	1
α-helix	144-151	8
α-helix	152-155	4
α-helix	158-160	3
β-strand	165-170	6	4
β-strand	175-181	7	4
β-strand	184-185	2	4
β-strand	191-193	3	4
α-helix	197-211	15
α-helix	217-219	3
α-helix	220-230	11
α-helix	239-247	9
α-helix	249-252	4
β-strand	254-259	6	5
β-strand	266-271	6	5
α-helix	273-275	3
α-helix	279-281	3
α-helix	285-287	3
α-helix	296-305	10
α-helix	309-311	3
α-helix	312-316	5
β-strand	319-323	5	4
α-helix	331-354	24
α-helix	360-363	4
β-strand	367-368	2	4
α-helix	376-385	10
α-helix	388-392	5
α-helix	397-401	5
α-helix	405-408	4

Chain B: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	6
β-strand	17-22	6	6
β-strand	30-33	4	6
β-strand	36-39	4	7
β-strand	56-57	2	7
α-helix	60-63	4
β-strand	68-71	4	7
β-strand	74-75	2	8
β-strand	78-79	2	8
α-helix	82-92	11
β-strand	105-111	7	6
α-helix	117-125	9
α-helix	126-130	5
β-strand	135-140	6	6
α-helix	141-149	9
β-strand	154-159	6	9
β-strand	164-170	7	9
β-strand	173-174	2	9
α-helix	176-178	3
β-strand	180-182	3	9
α-helix	186-198	13
α-helix	210-220	11
α-helix	227-236	10
β-strand	242-245	4	10
β-strand	251-254	4	10
α-helix	257-260	4
α-helix	261-265	5
α-helix	268-271	4
α-helix	278-287	10
α-helix	294-298	5
β-strand	301-305	5	9
α-helix	313-328	16
α-helix	335-339	5
β-strand	344-345	2	9
α-helix	353-364	12
β-strand	373-374	2	6
α-helix	375-380	6
α-helix	385-388	4

Chain C: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	11
α-helix	10-11	2
β-strand	14-16	3	12
β-strand	22-25	4	12
β-strand	31-38	8	12
β-strand	41-49	9	12
β-strand	55-60	6	13
β-strand	67-71	5	13
β-strand	76-82	7	13
β-strand	85-91	7	13
β-strand	99-104	6	14
β-strand	110-115	6	14
β-strand	120-126	7	14
β-strand	131-137	7	14
β-strand	145-150	6	15
β-strand	156-161	6	15
β-strand	166-170	5	15
β-strand	194-198	5	15
β-strand	203	1	16
β-strand	209-212	4	17
β-strand	218-222	5	17
β-strand	227-232	6	17
β-strand	238-243	6	17
β-strand	249-254	6	18
β-strand	259-264	6	18
β-strand	270-274	5	18
β-strand	280-285	6	18
α-helix	293-311	19
β-strand	327-332	6	11
β-strand	342-347	6	11
β-strand	351-356	6	11
α-helix	357-363	7

Chain D: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
α-helix	10-23	14
α-helix	26-28	3
β-strand	33-36	4	19
β-strand	42-46	5	19
α-helix	48-50	3
β-strand	54-55	2	20
β-strand	56-60	5	19
α-helix	64-69	6
α-helix	72-79	8
β-strand	84	1	21
α-helix	86-88	3
β-strand	93-94	2	19
β-strand	95	1	21
β-strand	97-98	2	20
α-helix	107-114	8
α-helix	116-134	19
α-helix	139-141	3
β-strand	142-144	3	22
β-strand	151-156	6	22
β-strand	161-168	8	22
α-helix	172-187	16
α-helix	195-196	2
β-strand	197-202	6	22
β-strand	220-227	8	22
α-helix	238-244	7
α-helix	248-279	32

Chain E: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	23
α-helix	33	1
β-strand	34	1	23
α-helix	41-52	12
α-helix	64-84	21
α-helix	89-100	12
α-helix	104-105	2
α-helix	118-120	3
α-helix	123-148	26
β-strand	149-150	2	24
β-strand	155-156	2	24
α-helix	168-170	3

Chain F: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-18	14
α-helix	37-40	4
α-helix	44-46	3
β-strand	47	1	25
α-helix	48-50	3
β-strand	51-54	4	26
β-strand	60-65	6	26
β-strand	66	1	25
β-strand	69-74	6	26
α-helix	81-96	16
β-strand	104	1	26
α-helix	108-109	2
β-strand	114-119	6	26
α-helix	120-125	6
α-helix	128-166	39

Chain G: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	11-13	3
α-helix	17-19	3
α-helix	39-48	10
α-helix	51-58	8
α-helix	69-83	15
α-helix	91-95	5
α-helix	100-113	14
α-helix	121-136	16
α-helix	139-145	7
β-strand	147	1	16

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	889-903	15
α-helix	910-911	2
α-helix	912-915	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-related protein 3	A	protein	418	Bos taurus	P61157 (AlphaFold model)
Actin-related protein 2	B	protein	394	Bos taurus	A7MB62 (AlphaFold model)
Actin-related protein 2/3 complex subunit 1A	C	protein	370	Bos taurus	Q1JP79 (AlphaFold model)
Actin-related protein 2/3 complex subunit 2	D	protein	300	Bos taurus	Q3MHR7 (AlphaFold model)
Actin-related protein 2/3 complex subunit 3	E	protein	178	Bos taurus	Q3T035
Actin-related protein 2/3 complex subunit 4	F	protein	168	Bos taurus	Q148J6
Actin-related protein 2/3 complex subunit 5	G	protein	151	Bos taurus	Q3SYX9
Coronin-7	H	protein	38	Homo sapiens	P57737

Sequence of entity 1 (A), FASTA

>9EAM_1 Actin-related protein 3 (chains A)
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Sequence of entity 2 (B), FASTA

>9EAM_2 Actin-related protein 2 (chains B)
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR

Sequence of entity 3 (C), FASTA

>9EAM_3 Actin-related protein 2/3 complex subunit 1A (chains C)
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGGQWVKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM

Sequence of entity 4 (D), FASTA

>9EAM_4 Actin-related protein 2/3 complex subunit 2 (chains D)
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSIS
LKFYKELQAHGADELLKRVYGSYLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKV
FMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNT
INLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

Sequence of entity 5 (E), FASTA

>9EAM_5 Actin-related protein 2/3 complex subunit 3 (chains E)
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

Sequence of entity 6 (F), FASTA

>9EAM_6 Actin-related protein 2/3 complex subunit 4 (chains F)
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEK
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF

Sequence of entity 7 (G), FASTA

>9EAM_7 Actin-related protein 2/3 complex subunit 5 (chains G)
MSKNTVSSARFRKVDVGEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALK
NPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDN
SSAVLLQWHEKALAAGGVGSIVRVLTARKTV

Sequence of entity 8 (H), FASTA

>9EAM_8 Coronin-7 (chains H)
SDQQKKEELLNAMVAKLGNREDPLPQDSFEGVDEDEWD

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	2

Primary citation

Coronin-7 is an Arp2/3 complex debrancher. Fregoso, F.E., Barrie, K.R., Saks, A.J. et al. To be published.

Other PDB entries of the same protein (UniProt P61157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1K8K 2.0 Å, Crystal Structure of Arp2/3 Complex
2P9I 2.46 Å, Crystal Structure of bovine Arp2/3 Complex co-crystallized with ADP and crosslinked with…
3UKR 2.48 Å, Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
3ULE 2.5 Å, Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
1TYQ 2.55 Å, Crystal structure of Arp2/3 complex with bound ATP and calcium
1U2V 2.55 Å, Crystal structure of Arp2/3 complex with bound ADP and calcium
2P9K 2.59 Å, Crystal structure of bovine Arp2/3 complex co-crystallized with ATP and crosslinked with…
2P9L 2.65 Å, Crystal Structure of bovine Arp2/3 complex
3RSE 2.65 Å, Structural and biochemical characterization of two binding sites for nucleation…
2P9S 2.68 Å, Structure of bovine Arp2/3 complex co-crystallized with ATP/Mg2+
3DXK 2.7 Å, Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
2P9U 2.75 Å, Crystal structure of bovine Arp2/3 complex co-crystallized with AMP-PNP and calcium

Browse structure collections

About this viewer

MolViewer shows 9EAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.