Ternary structure of 14-3-3s, C-RAF phosphopeptide 12mer (pS259) and compound 86 (1124384). Determined by X-ray diffraction at 1.6 Å resolution. Released 16 Apr 2025.
Explore 9EW4 in 3D Show helices and sheets RCSB PDB PDBe
9EW4 contains 17 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 34-36 | 3 | |
| α-helix | 38-69 | 32 | |
| α-helix | 74-76 | 3 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 256-258 | 3 | |
| α-helix | 260-262 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 236 | Homo sapiens | P31947 (AlphaFold model) |
| RAF proto-oncogene serine/threonine-protein kinase | P | protein | 9 | Homo sapiens | P04049 (AlphaFold model) |
>9EW4_1 14-3-3 protein sigma (chains A) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
>9EW4_2 RAF proto-oncogene serine/threonine-protein kinase (chains P) QRSTSTPNV
| ID | Name | Formula | Copies |
|---|---|---|---|
| WQ9 | 1-[(5~{R})-2-(4-bromanyl-3-fluoranyl-phenyl)sulfonyl-2,7-diazaspiro[4.4]nonan-7… | C15 H17 Br Cl F N2 O3 S | 1 |
| MG | Magnesium ion | Mg | 4 |
Water and common crystallization additives (CL) are not listed.
Modulation of the 14-3-3 sigma /C-RAF "Auto"inhibited Complex by Molecular Glues. Konstantinidou, M., Vickery, H.R., Pennings, M.A.M. et al. J Am Chem Soc (2026) 148:4951-4965. DOI 10.1021/jacs.5c12622 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9EW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.