9EW5: 14-3-3 protein sigma

Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) 12mer and compound 23 (1083848). Determined by X-ray diffraction at 1.5 Å resolution. Released 16 Apr 2025.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,303
Mol. weight: 56.82 kDa
Ligands: MG, CA, WQI
Released: 16 Apr 2025

Explore 9EW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EW5 contains 30 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-37	4
α-helix	38-69	32
α-helix	80-102	23
α-helix	103-107	5
α-helix	114-134	21
α-helix	137-161	25
α-helix	167-182	16
α-helix	187-203	17
α-helix	205-207	3
α-helix	210-212	3
α-helix	213-230	18

Chains C and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	256-258	3

Chain D: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	-2-0	3
α-helix	3-15	13
α-helix	19-30	12
α-helix	34-36	3
α-helix	38-72	35
α-helix	79-102	24
α-helix	103-107	5
α-helix	108-110	3
α-helix	114-134	21
α-helix	137-161	25
α-helix	167-178	12
α-helix	179-183	5
α-helix	187-202	16
α-helix	205-207	3
α-helix	213-229	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein sigma	A, D	protein	236	Homo sapiens	P31947 (AlphaFold model)
RAF proto-oncogene serine/threonine-protein kinase	C, F	protein	11	Homo sapiens	P04049 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>9EW5_1 14-3-3 protein sigma (chains A, D)
GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ
RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE
SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN
FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (C, F), FASTA

>9EW5_2 RAF proto-oncogene serine/threonine-protein kinase (chains C, F)
QRSTSTPNVHM

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
CA	Calcium ion	Ca	3
WQI	2-chloranyl-~{N}-[[1-(4-iodophenyl)sulfonylpiperidin-4-yl]methyl]ethanamide	C14 H18 Cl I N2 O3 S	2

Primary citation

Modulation of the 14-3-3 sigma /C-RAF "Auto"inhibited Complex by Molecular Glues. Konstantinidou, M., Vickery, H.R., Pennings, M.A.M. et al. J Am Chem Soc (2026) 148:4951-4965. DOI 10.1021/jacs.5c12622 · PubMed

Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IQU 1.05 Å, Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer)
7AZ2 1.08 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound LvD1014
6HMT 1.1 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C42 mutant bound to…
7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
9GG8 1.1 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS214 peptide and…
8ANC 1.11 Å, 14-3-3 sigma sirtuin-3 phospho-peptide complex
6Y1J 1.13 Å, 14-3-3 sigma in complex with IkappaBalpha pS63 peptide
6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
6NV2 1.13 Å, 14-3-3 sigma with RelA/p65 binding site pS45 in complex with DP005

Browse structure collections

About this viewer

MolViewer shows 9EW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.