Identification of zinc ions in LMO4. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Oct 2024.
Explore 9F5B in 3D Show helices and sheets RCSB PDB PDBe
9F5B contains 10 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-21 | 2 | |
| β-strand | 22 | 1 | 1 |
| β-strand | 23 | 1 | 2 |
| β-strand | 29 | 1 | 1 |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 41-43 | 3 | 2 |
| α-helix | 45-47 | 3 | |
| β-strand | 49 | 1 | 3 |
| β-strand | 56 | 1 | 3 |
| α-helix | 57-60 | 4 | |
| β-strand | 63-67 | 5 | 4 |
| β-strand | 70-72 | 3 | 4 |
| α-helix | 74-81 | 8 | |
| β-strand | 85-86 | 2 | 5 |
| β-strand | 93-94 | 2 | 5 |
| β-strand | 99-100 | 2 | 6 |
| β-strand | 101-103 | 3 | 7 |
| β-strand | 106-108 | 3 | 7 |
| α-helix | 110-112 | 3 | |
| β-strand | 114 | 1 | 8 |
| α-helix | 120 | 1 | |
| β-strand | 121 | 1 | 8 |
| α-helix | 122 | 1 | |
| β-strand | 127-131 | 5 | 9 |
| β-strand | 134-137 | 4 | 9 |
| α-helix | 138-140 | 3 | |
| α-helix | 143-146 | 4 | |
| β-strand | 302-303 | 2 | 9 |
| α-helix | 304-307 | 4 | |
| β-strand | 308-309 | 2 | 6 |
| β-strand | 319-321 | 3 | 4 |
| β-strand | 323-326 | 4 | 2 |
| β-strand | 337-338 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LIM domain transcription factor LMO4,LIM domain-binding protein 1 | A | protein | 188 | Homo sapiens | P61968 (AlphaFold model), Q86U70 (AlphaFold model) |
>9F5B_1 LIM domain transcription factor LMO4,LIM domain-binding protein 1 (chains A) GSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSSCQAQLGDIGTSSYTKSGMILCRN DYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSL FCEHDRPTALINGHLNSGGSGGSGGSGGDVMVVGEPTLMGGEFGDEDERLITRLENTQFD AANGIDDE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Utilizing anomalous signals for element identification in macromolecular crystallography. El Omari, K., Forsyth, I., Duman, R. et al. Acta Crystallogr D Struct Biol (2024) 80:713-721. DOI 10.1107/S2059798324008659 · PubMed
MolViewer shows 9F5B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.