9FEL: PAmCherry1 protein

Name: PDB 9FEL: LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins
Published: 2025-07-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

LSSmCherry1 - Directionality of Optical Properties of Fluorescent Proteins. Determined by X-ray diffraction at 1.5 Å resolution. Released 2 Jul 2025.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Discosoma sp.
Chains: 2
Atoms: 3,916
Mol. weight: 61.1 kDa
Released: 2 Jul 2025

Explore 9FEL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9FEL contains 12 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	1
β-strand	25-36	12	1
β-strand	41-50	10	1
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
β-strand	74	1	1
α-helix	82-85	4
β-strand	91-99	9	1
β-strand	104-114	11	1
β-strand	117-127	11	1
β-strand	140-143	4	1
β-strand	146-153	8	1
β-strand	156-167	12	1
β-strand	172-183	12	1
β-strand	193-204	12	1
β-strand	210-220	11	1

Chain L: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	12-22	11	2
β-strand	25-36	12	2
β-strand	41-50	10	2
α-helix	52	1
α-helix	54	1
α-helix	58-60	3
α-helix	62-64	3
β-strand	74	1	2
α-helix	82-85	4
β-strand	91-99	9	2
β-strand	104-114	11	2
β-strand	117-127	11	2
β-strand	140-143	4	2
α-helix	144-145	2
β-strand	146-153	8	2
β-strand	156-167	12	2
α-helix	168-170	3
β-strand	172-183	12	2
α-helix	188-190	3
β-strand	193-204	12	2
β-strand	210-220	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PAmCherry1 protein	A, L	protein	266	Discosoma sp.	D1MPT3 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>9FEL_1 PAmCherry1 protein (chains A, L)
HHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRMVSKGEEDNMTIIKEFMRFKVHMEGSVN
GHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYL
KLSFPEGFNWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQCRTMGL
EASTERMYPEDGALKGESKERLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVDIKLDILS
HNEDYTIVEQYERSEGRHSTGGMDELYK

Primary citation

Directionality of Optical Properties of Fluorescent Proteins. Myskova, J., Brynda, J., Khoroshyy, P. et al. To be published.

Other PDB entries of the same protein (UniProt D1MPT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NED 0.95 Å, mRouge
6MZ3 1.09 Å, mCherry pH sensitive mutant - M66T (mCherryTYG)
3LF3 1.15 Å, Crystal Structure of Fast Fluorescent Timer Fast-FT
7SAK 1.15 Å, Crystal Structure of LaM4 Nanobody bound to mCherry
31AL 1.5 Å, Synchrotron structure of non-photoactivated PAmCherry1
3KCS 1.5 Å, Crystal structure of PAmCherry1 in the dark state
6YLM 1.6 Å, mCherry
31JT 1.63 Å, SFX structure of non-photoactivated PAmCherry1
3KCT 1.65 Å, CRYSTAL STRUCTURE OF PAmCherry1 in the photoactivated state
3NEZ 1.7 Å, mRojoA
5H89 1.76 Å, Crystal structure of mRojoA mutant - T16V - P63Y - W143G - L163V
3LF4 1.81 Å, Crystal Structure of Fluorescent Timer Precursor Blue102

Browse structure collections

About this viewer

MolViewer shows 9FEL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.